SURF6 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SURF6 - Surfeit locus protein 6

PFAM:	PF04935	Sequences: SRQELLEKRRKRKEERKRKKKERKEKAKKEKARKKKEKEKKKEEEEAEKSASESSPSPPKPVEESEGNLVFGKVDFGDGELSSKKKKKKKKGPTGKDPKQLLKKLEAKKEKLEELDEEKAKEIEEKDKWLKALKRAEGEKVKDDPKLLKKALKRKEKKKKKSKKEWKERKEGVEKKKAERQKKREENIAKRKEEKKEKKKKKAKKKG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	207 (196)
Sequences:	679 (543)
Seq/√Len:	38.8
META:	0.218

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
157_K	160_K	4.889	1.00
117_E	121_K	3.910	1.00
189_A	193_E	2.924	1.00
190_K	194_E	2.912	1.00
178_A	182_K	2.817	1.00
103_K	106_E	2.704	1.00
19_K	23_R	2.555	1.00
98_P	101_L	2.418	1.00
175_K	179_E	2.405	1.00
181_Q	184_R	2.392	1.00
106_E	149_K	2.381	1.00
161_K	165_E	2.276	1.00
7_E	10_R	2.222	0.99
108_K	127_D	2.167	0.99
188_I	191_R	2.140	0.99
172_G	176_K	2.120	0.99
132_A	135_R	2.115	0.99
55_S	58_P	1.890	0.98
170_K	177_K	1.847	0.98
131_K	135_R	1.839	0.98
196_K	199_K	1.816	0.98
172_G	175_K	1.773	0.97
95_G	98_P	1.766	0.97
97_D	155_K	1.750	0.97
112_L	115_L	1.710	0.97
171_E	174_E	1.695	0.96
119_K	123_I	1.691	0.96
98_P	105_L	1.672	0.96
21_K	25_E	1.666	0.96
20_K	23_R	1.626	0.95
203_A	206_K	1.624	0.95
105_L	145_P	1.593	0.95
198_K	202_K	1.587	0.95
141_V	147_L	1.556	0.94
94_T	98_P	1.545	0.94
101_L	105_L	1.536	0.94
16_R	27_A	1.513	0.93
52_S	55_S	1.502	0.93
129_W	187_N	1.488	0.93
97_D	100_Q	1.471	0.92
53_E	56_P	1.467	0.92
116_D	119_K	1.462	0.92
92_G	97_D	1.460	0.92
10_R	13_K	1.453	0.92
18_R	22_E	1.447	0.92
9_R	12_R	1.432	0.91
184_R	188_I	1.415	0.91
98_P	152_L	1.404	0.90
57_S	60_K	1.398	0.90
15_E	18_R	1.370	0.89
21_K	26_K	1.363	0.89
184_R	187_N	1.353	0.89
6_L	11_K	1.348	0.88
109_K	145_P	1.346	0.88
17_K	23_R	1.326	0.88
159_K	193_E	1.317	0.87
193_E	197_E	1.314	0.87
49_K	52_S	1.310	0.87
26_K	30_E	1.308	0.87
13_K	17_K	1.294	0.86
12_R	23_R	1.292	0.86
158_K	162_S	1.281	0.86
200_K	204_K	1.278	0.86
120_A	124_E	1.267	0.85
110_E	114_E	1.254	0.84
201_K	204_K	1.252	0.84
150_K	198_K	1.240	0.84
116_D	120_A	1.230	0.83
153_K	159_K	1.215	0.82
134_K	139_E	1.207	0.82
68_N	72_G	1.186	0.81
183_K	187_N	1.185	0.81
183_K	186_E	1.182	0.81
76_F	150_K	1.178	0.80
200_K	203_A	1.175	0.80
104_K	110_E	1.174	0.80
44_E	49_K	1.172	0.80
150_K	162_S	1.167	0.80
100_Q	103_K	1.162	0.80
21_K	30_E	1.147	0.79
46_E	49_K	1.138	0.78
99_K	156_E	1.135	0.78
72_G	75_D	1.133	0.78
164_K	177_K	1.132	0.78
12_R	17_K	1.128	0.77
151_A	155_K	1.126	0.77
43_E	51_A	1.109	0.76
144_D	147_L	1.107	0.76
12_R	20_K	1.106	0.76
50_S	53_E	1.104	0.76
163_K	167_K	1.103	0.76
10_R	14_E	1.102	0.76
67_G	74_V	1.095	0.75
23_R	28_K	1.089	0.75
135_R	141_V	1.085	0.75
21_K	27_A	1.083	0.75
89_K	119_K	1.082	0.74
185_E	189_A	1.075	0.74
129_W	184_R	1.066	0.73
105_L	109_K	1.049	0.72
85_K	88_K	1.049	0.72
182_K	186_E	1.048	0.72
45_E	51_A	1.043	0.72
11_K	152_L	1.042	0.72
29_K	33_R	1.030	0.71
47_A	51_A	1.018	0.70
117_E	120_A	1.013	0.69
46_E	50_S	1.008	0.69
105_L	134_K	0.995	0.68
111_K	139_E	0.979	0.67
53_E	58_P	0.969	0.66
19_K	30_E	0.959	0.65
174_E	178_A	0.957	0.65
196_K	200_K	0.955	0.65
101_L	104_K	0.951	0.64
53_E	57_S	0.945	0.64
101_L	145_P	0.944	0.64
109_K	113_E	0.938	0.63
18_R	28_K	0.936	0.63
61_P	64_E	0.934	0.63
108_K	133_L	0.929	0.63
74_V	203_A	0.915	0.61
105_L	186_E	0.911	0.61
118_E	121_K	0.906	0.61
157_K	178_A	0.902	0.60
99_K	109_K	0.901	0.60
47_A	52_S	0.900	0.60
192_K	203_A	0.893	0.60
115_L	164_K	0.893	0.60
127_D	176_K	0.892	0.59
119_K	122_E	0.891	0.59
76_F	177_K	0.888	0.59
191_R	194_E	0.886	0.59
131_K	190_K	0.884	0.59
49_K	54_S	0.882	0.59
98_P	155_K	0.879	0.58
183_K	199_K	0.867	0.57
69_L	74_V	0.864	0.57
17_K	21_K	0.846	0.55
19_K	27_A	0.846	0.55
90_K	174_E	0.842	0.55
48_E	63_E	0.838	0.55
19_K	32_A	0.833	0.54
78_D	92_G	0.832	0.54
48_E	51_A	0.832	0.54
75_D	151_A	0.830	0.54
57_S	61_P	0.830	0.54
46_E	52_S	0.821	0.53
32_A	59_P	0.818	0.53
61_P	144_D	0.810	0.52
97_D	129_W	0.809	0.52
104_K	108_K	0.803	0.52
119_K	126_K	0.794	0.51
23_R	27_A	0.792	0.51
150_K	159_K	0.789	0.50
179_E	197_E	0.788	0.50
88_K	177_K	0.786	0.50
56_P	59_P	0.779	0.49
76_F	97_D	0.774	0.49
78_D	144_D	0.774	0.49
111_K	130_L	0.773	0.49
110_E	122_E	0.771	0.49
47_A	50_S	0.770	0.49
170_K	174_E	0.769	0.48
182_K	189_A	0.766	0.48
113_E	170_K	0.765	0.48
179_E	182_K	0.765	0.48
43_E	49_K	0.764	0.48
192_K	199_K	0.763	0.48
154_R	162_S	0.762	0.48
115_L	120_A	0.740	0.46
22_E	151_A	0.736	0.46
177_K	190_K	0.734	0.45
136_A	175_K	0.731	0.45
131_K	141_V	0.731	0.45
191_R	195_K	0.730	0.45
88_K	202_K	0.729	0.45
99_K	103_K	0.729	0.45
16_R	28_K	0.728	0.45
87_K	90_K	0.728	0.45
28_K	180_R	0.725	0.45
80_E	86_K	0.725	0.45
46_E	51_A	0.722	0.44
69_L	73_K	0.719	0.44
46_E	56_P	0.717	0.44
106_E	144_D	0.716	0.44
192_K	196_K	0.713	0.43
126_K	173_V	0.708	0.43
188_I	192_K	0.700	0.42
152_L	162_S	0.699	0.42
52_S	61_P	0.698	0.42
98_P	151_A	0.694	0.42
165_E	206_K	0.693	0.42
179_E	189_A	0.689	0.41
51_A	57_S	0.683	0.41
134_K	150_K	0.683	0.41
8_K	11_K	0.677	0.40
126_K	135_R	0.672	0.40
90_K	206_K	0.671	0.40
162_S	176_K	0.671	0.40
43_E	59_P	0.668	0.40
11_K	32_A	0.667	0.39
15_E	19_K	0.659	0.39
111_K	174_E	0.654	0.38
13_K	18_R	0.651	0.38
15_E	22_E	0.651	0.38
130_L	134_K	0.646	0.38
81_L	84_K	0.643	0.37
103_K	141_V	0.642	0.37
67_G	75_D	0.641	0.37
107_A	122_E	0.639	0.37
47_A	111_K	0.638	0.37
72_G	189_A	0.633	0.37
168_E	194_E	0.632	0.36
147_L	154_R	0.632	0.36
137_E	145_P	0.629	0.36
44_E	50_S	0.628	0.36
13_K	29_K	0.627	0.36
171_E	175_K	0.621	0.36
173_V	180_R	0.620	0.35
24_K	42_K	0.620	0.35
111_K	127_D	0.619	0.35
128_K	175_K	0.618	0.35
16_R	154_R	0.618	0.35
59_P	63_E	0.618	0.35
92_G	185_E	0.617	0.35
7_E	32_A	0.614	0.35
174_E	182_K	0.613	0.35
58_P	61_P	0.610	0.35
75_D	199_K	0.610	0.35
191_R	196_K	0.605	0.34
157_K	200_K	0.605	0.34
168_E	189_A	0.605	0.34
86_K	188_I	0.605	0.34
124_E	197_E	0.605	0.34
28_K	121_K	0.605	0.34
76_F	79_G	0.601	0.34
15_E	30_E	0.593	0.33
105_L	124_E	0.586	0.33
197_E	205_K	0.585	0.33
170_K	173_V	0.581	0.32
25_E	30_E	0.579	0.32
105_L	154_R	0.578	0.32
45_E	48_E	0.577	0.32
190_K	199_K	0.574	0.32
20_K	119_K	0.574	0.32
131_K	136_A	0.573	0.32
13_K	22_E	0.572	0.32
13_K	21_K	0.569	0.31
75_D	196_K	0.568	0.31
153_K	156_E	0.567	0.31
151_A	185_E	0.562	0.31
124_E	162_S	0.560	0.31
142_K	148_L	0.559	0.31
47_A	53_E	0.557	0.30
165_E	168_E	0.556	0.30
15_E	20_K	0.554	0.30
94_T	100_Q	0.550	0.30
74_V	77_G	0.547	0.30
49_K	53_E	0.547	0.30
8_K	16_R	0.546	0.30
54_S	58_P	0.545	0.30
12_R	22_E	0.545	0.30
168_E	191_R	0.542	0.29
18_R	168_E	0.542	0.29
126_K	152_L	0.542	0.29
20_K	33_R	0.542	0.29
97_D	148_L	0.541	0.29
19_K	134_K	0.539	0.29
49_K	56_P	0.536	0.29
59_P	66_E	0.533	0.29
166_W	169_R	0.530	0.28
11_K	16_R	0.527	0.28
72_G	76_F	0.526	0.28
84_K	88_K	0.526	0.28
22_E	28_K	0.523	0.28
161_K	203_A	0.523	0.28
44_E	48_E	0.517	0.27
98_P	144_D	0.516	0.27
135_R	183_K	0.515	0.27
79_G	165_E	0.511	0.27
12_R	24_K	0.509	0.27
27_A	30_E	0.507	0.27
132_A	193_E	0.507	0.27
17_K	27_A	0.506	0.27
71_F	133_L	0.506	0.27
19_K	22_E	0.506	0.27
97_D	156_E	0.504	0.27
64_E	70_V	0.503	0.26
18_R	23_R	0.502	0.26
81_L	85_K	0.502	0.26
11_K	15_E	0.501	0.26
42_K	46_E	0.501	0.26
174_E	177_K	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2enkA	1	0.1691	1.2	0.961	Contact Map
4a17T	1	0	0.9	0.963	Contact Map
4kp3E	1	0.0676	0.7	0.966	Contact Map
3j39W	1	0.2174	0.7	0.966	Contact Map
4w20W	1	0	0.6	0.967	Contact Map
3vhjA	1	0.2415	0.6	0.967	Contact Map
4lx2B	1	0.058	0.6	0.968	Contact Map
3fgxA	2	0.1739	0.6	0.968	Contact Map
3m91A	2	0.0821	0.6	0.968	Contact Map
2ygvE	1	0.0966	0.6	0.969	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.