Wzy_C - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Wzy_C - O-Antigen ligase

PFAM:	PF04932	Sequences: IALLLLLLALLLTGSRGAWLALLVALLVLLLLLLRRRRRRLLLLLALLGVLLLLALLVLSSRLERLGSITFAFSALDQKSSGEDGSLSGRLEIWRAALEMIKDHPLLGVGFFGFGAFYFAYLYYAYSGGGGVVDHAHNDYLQILAELGIVGLLLFL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	156 (143)
Sequences:	124159 (108971)
Seq/√Len:	9112.6
META:	0.899

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
101_I	144_L	4.902	1.00
104_H	109_V	4.858	1.00
147_L	151_G	3.379	1.00
142_Q	146_E	2.810	1.00
144_L	152_L	2.730	1.00
101_I	149_I	2.454	1.00
136_A	142_Q	2.357	1.00
98_L	102_K	2.338	1.00
94_W	141_L	2.317	1.00
100_M	109_V	2.268	1.00
135_H	142_Q	2.020	1.00
97_A	136_A	1.994	1.00
62_R	65_R	1.885	1.00
97_A	141_L	1.864	1.00
109_V	145_A	1.740	1.00
96_A	99_E	1.654	1.00
102_K	105_P	1.646	1.00
28_V	32_L	1.621	1.00
53_L	57_L	1.565	1.00
29_L	33_L	1.562	1.00
139_D	142_Q	1.505	1.00
63_L	66_L	1.449	1.00
100_M	145_A	1.447	1.00
91_L	95_R	1.436	1.00
65_R	68_S	1.428	1.00
62_R	66_L	1.421	1.00
104_H	107_L	1.412	1.00
54_L	58_V	1.375	1.00
150_V	154_L	1.370	1.00
52_L	56_L	1.365	1.00
41_L	44_L	1.363	1.00
100_M	103_D	1.360	1.00
8_L	12_L	1.352	1.00
40_R	44_L	1.336	1.00
60_S	65_R	1.326	1.00
95_R	99_E	1.323	1.00
114_F	118_Y	1.319	1.00
97_A	145_A	1.307	1.00
15_S	18_A	1.274	1.00
150_V	153_L	1.263	1.00
92_E	95_R	1.257	1.00
99_E	102_K	1.253	1.00
54_L	57_L	1.221	1.00
143_I	147_L	1.212	1.00
113_G	117_F	1.203	1.00
60_S	64_E	1.195	1.00
59_L	62_R	1.194	1.00
116_A	119_F	1.190	1.00
98_L	101_I	1.188	1.00
25_A	29_L	1.149	1.00
89_G	93_I	1.140	1.00
53_L	56_L	1.136	1.00
93_I	133_V	1.132	1.00
30_L	34_L	1.130	1.00
140_Y	152_L	1.118	1.00
69_I	72_A	1.114	1.00
65_R	69_I	1.112	1.00
59_L	63_L	1.100	1.00
17_G	21_A	1.097	1.00
113_G	116_A	1.087	1.00
96_A	100_M	1.080	1.00
139_D	143_I	1.080	1.00
135_H	139_D	1.066	1.00
49_G	53_L	1.059	1.00
87_L	91_L	1.054	1.00
93_I	137_H	1.043	1.00
115_G	119_F	1.041	1.00
144_L	149_I	1.035	1.00
84_D	87_L	1.003	1.00
64_E	67_G	1.002	1.00
101_I	105_P	0.981	1.00
143_I	152_L	0.976	1.00
116_A	120_A	0.974	1.00
34_L	38_R	0.970	1.00
88_S	91_L	0.969	1.00
61_S	65_R	0.967	1.00
10_L	18_A	0.962	1.00
56_L	60_S	0.959	1.00
102_K	149_I	0.956	1.00
138_N	141_L	0.956	1.00
93_I	136_A	0.951	1.00
118_Y	121_Y	0.951	1.00
61_S	64_E	0.945	1.00
66_L	69_I	0.939	1.00
143_I	155_F	0.930	1.00
115_G	118_Y	0.924	1.00
120_A	123_Y	0.913	1.00
113_G	118_Y	0.910	1.00
115_G	120_A	0.903	1.00
6_L	9_A	0.903	1.00
86_S	91_L	0.900	1.00
103_D	109_V	0.896	1.00
119_F	122_L	0.891	1.00
97_A	101_I	0.889	1.00
114_F	117_F	0.880	1.00
63_L	68_S	0.867	1.00
62_R	67_G	0.865	1.00
14_G	19_W	0.864	1.00
115_G	121_Y	0.863	1.00
99_E	103_D	0.856	1.00
34_L	37_R	0.854	1.00
10_L	22_L	0.851	1.00
46_A	50_V	0.850	1.00
113_G	119_F	0.850	1.00
23_L	27_L	0.850	1.00
114_F	120_A	0.849	1.00
50_V	54_L	0.847	1.00
94_W	138_N	0.842	1.00
41_L	45_L	0.841	1.00
101_I	150_V	0.839	1.00
42_L	45_L	0.833	1.00
43_L	46_A	0.828	1.00
33_L	37_R	0.826	1.00
35_R	38_R	0.816	1.00
101_I	145_A	0.813	1.00
117_F	120_A	0.808	1.00
92_E	96_A	0.800	1.00
55_A	59_L	0.799	1.00
66_L	70_T	0.798	1.00
60_S	63_L	0.795	1.00
40_R	43_L	0.789	1.00
84_D	88_S	0.788	1.00
5_L	9_A	0.787	1.00
27_L	31_L	0.784	1.00
31_L	35_R	0.783	1.00
25_A	32_L	0.782	1.00
57_L	60_S	0.772	1.00
85_G	88_S	0.772	1.00
117_F	121_Y	0.769	1.00
52_L	55_A	0.765	1.00
50_V	53_L	0.765	1.00
121_Y	124_Y	0.758	1.00
63_L	67_G	0.756	1.00
26_L	30_L	0.752	1.00
101_I	152_L	0.745	1.00
49_G	52_L	0.745	1.00
55_A	58_V	0.739	1.00
67_G	70_T	0.735	1.00
122_L	125_A	0.734	1.00
61_S	66_L	0.730	1.00
121_Y	125_A	0.725	1.00
86_S	89_G	0.723	1.00
57_L	61_S	0.722	1.00
147_L	154_L	0.720	1.00
39_R	42_L	0.711	1.00
136_A	145_A	0.710	1.00
114_F	119_F	0.707	1.00
44_L	47_L	0.703	1.00
113_G	120_A	0.702	1.00
136_A	139_D	0.699	1.00
113_G	122_L	0.691	1.00
3_L	7_L	0.684	1.00
97_A	100_M	0.682	1.00
90_R	137_H	0.677	1.00
91_L	94_W	0.677	1.00
48_L	52_L	0.675	1.00
46_A	49_G	0.674	1.00
21_A	25_A	0.670	1.00
118_Y	122_L	0.668	1.00
131_G	134_D	0.664	1.00
97_A	144_L	0.663	1.00
58_V	62_R	0.663	1.00
117_F	123_Y	0.658	1.00
124_Y	127_S	0.657	1.00
63_L	69_I	0.655	1.00
3_L	6_L	0.655	1.00
123_Y	126_Y	0.651	1.00
64_E	68_S	0.641	1.00
47_L	50_V	0.640	1.00
42_L	57_L	0.636	1.00
42_L	46_A	0.634	1.00
9_A	13_T	0.633	1.00
7_L	22_L	0.631	1.00
45_L	49_G	0.623	1.00
59_L	65_R	0.622	1.00
136_A	141_L	0.620	1.00
137_H	142_Q	0.611	1.00
147_L	150_V	0.605	1.00
119_F	123_Y	0.603	1.00
51_L	54_L	0.603	1.00
110_G	146_E	0.601	1.00
49_G	56_L	0.600	1.00
51_L	55_A	0.599	1.00
113_G	121_Y	0.598	1.00
144_L	150_V	0.591	1.00
39_R	43_L	0.586	1.00
31_L	34_L	0.585	1.00
33_L	36_R	0.585	1.00
136_A	146_E	0.584	1.00
68_S	72_A	0.582	1.00
64_E	69_I	0.577	1.00
43_L	47_L	0.575	1.00
62_R	68_S	0.570	1.00
85_G	89_G	0.570	1.00
139_D	155_F	0.567	1.00
98_L	141_L	0.559	1.00
68_S	71_F	0.551	1.00
25_A	28_V	0.545	1.00
62_R	69_I	0.544	1.00
120_A	124_Y	0.541	1.00
44_L	48_L	0.539	1.00
27_L	30_L	0.539	1.00
10_L	13_T	0.532	1.00
149_I	153_L	0.530	1.00
140_Y	143_I	0.529	1.00
88_S	92_E	0.529	1.00
9_A	12_L	0.518	1.00
59_L	66_L	0.517	1.00
93_I	96_A	0.514	1.00
122_L	126_Y	0.510	1.00
93_I	135_H	0.508	1.00
89_G	137_H	0.506	1.00
107_L	150_V	0.501	1.00
4_L	8_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3wxwA	1	0.4038	10.6	0.884	Contact Map
2w3zA	1	0.4103	4.1	0.904	Contact Map
1afoA	2	0.1923	2.3	0.915	Contact Map
2ks1B	1	0.2244	1.9	0.919	Contact Map
3dl8E	1	0.3782	1.5	0.924	Contact Map
2jwaA	2	0.2179	1.5	0.924	Contact Map
5a63B	1	0.4744	1.3	0.927	Contact Map
3l1lA	2	0.4551	1.2	0.929	Contact Map
4ry2A	2	0.8846	1.1	0.93	Contact Map
4a82A	2	0.8846	1.1	0.93	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.