FUN14 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FUN14 - FUN14 family

PFAM:	PF04930	Sequences: LGGGFVIGFLVGYALKKVLKIAAVIVGLFFALLQYLEYQGIITVNWDKLESAVSSALDTWGDGLVGAALDFLTSNLPFAGGFAAGFLLGF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	90 (90)
Sequences:	2870 (2210)
Seq/√Len:	233.0
META:	0.802

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
35_Y	39_Q	3.550	1.00
41_I	52_A	3.169	1.00
29_F	32_L	2.281	1.00
45_N	48_K	2.114	1.00
47_D	50_E	1.981	1.00
28_L	32_L	1.973	1.00
33_L	42_I	1.898	1.00
13_Y	17_K	1.787	1.00
41_I	49_L	1.751	1.00
34_Q	37_E	1.740	1.00
50_E	54_S	1.717	1.00
80_G	84_A	1.663	1.00
4_G	78_F	1.658	1.00
3_G	7_I	1.626	1.00
63_G	67_A	1.597	1.00
58_D	62_D	1.584	1.00
5_F	9_F	1.567	1.00
30_F	34_Q	1.560	1.00
79_A	83_A	1.551	1.00
63_G	66_G	1.548	1.00
75_N	79_A	1.504	1.00
12_G	17_K	1.490	1.00
10_L	23_A	1.451	1.00
78_F	81_G	1.442	1.00
63_G	68_A	1.404	1.00
56_A	60_W	1.370	1.00
81_G	84_A	1.352	1.00
60_W	66_G	1.348	1.00
64_L	67_A	1.345	1.00
62_D	66_G	1.332	1.00
14_A	24_V	1.294	1.00
71_F	75_N	1.244	1.00
14_A	28_L	1.234	1.00
60_W	64_L	1.190	1.00
60_W	65_V	1.187	1.00
14_A	27_G	1.186	1.00
62_D	67_A	1.155	1.00
55_S	58_D	1.144	1.00
84_A	88_L	1.136	1.00
9_F	13_Y	1.098	1.00
24_V	27_G	1.072	1.00
69_L	75_N	1.069	1.00
60_W	63_G	1.066	1.00
65_V	68_A	1.066	1.00
29_F	33_L	1.063	1.00
11_V	82_F	1.059	1.00
41_I	48_K	1.039	1.00
3_G	6_V	1.015	1.00
58_D	61_G	1.014	1.00
48_K	52_A	1.011	1.00
15_L	37_E	0.981	1.00
36_L	42_I	0.970	1.00
36_L	41_I	0.964	1.00
14_A	31_A	0.964	1.00
7_I	10_L	0.958	1.00
33_L	44_V	0.957	1.00
83_A	87_L	0.954	1.00
38_Y	75_N	0.944	1.00
31_A	35_Y	0.938	1.00
15_L	86_F	0.936	1.00
2_G	5_F	0.929	1.00
59_T	68_A	0.915	1.00
23_A	34_Q	0.913	1.00
57_L	60_W	0.911	1.00
61_G	64_L	0.909	1.00
51_S	54_S	0.898	0.99
5_F	85_G	0.896	0.99
58_D	63_G	0.894	0.99
17_K	21_I	0.882	0.99
13_Y	20_K	0.874	0.99
60_W	67_A	0.870	0.99
77_P	81_G	0.858	0.99
77_P	80_G	0.841	0.99
75_N	78_F	0.839	0.99
31_A	34_Q	0.808	0.99
64_L	68_A	0.805	0.99
87_L	90_F	0.801	0.99
85_G	89_G	0.800	0.99
61_G	66_G	0.787	0.99
59_T	62_D	0.784	0.99
74_S	78_F	0.767	0.98
21_I	24_V	0.747	0.98
58_D	68_A	0.730	0.98
5_F	38_Y	0.719	0.98
13_Y	24_V	0.709	0.97
19_L	22_A	0.707	0.97
32_L	36_L	0.702	0.97
61_G	68_A	0.700	0.97
4_G	8_G	0.697	0.97
35_Y	38_Y	0.692	0.97
3_G	53_V	0.691	0.97
59_T	65_V	0.689	0.97
24_V	29_F	0.677	0.96
80_G	83_A	0.675	0.96
60_W	68_A	0.666	0.96
4_G	36_L	0.666	0.96
10_L	24_V	0.665	0.96
84_A	87_L	0.664	0.96
14_A	46_W	0.652	0.96
23_A	27_G	0.649	0.96
16_K	82_F	0.641	0.95
57_L	64_L	0.637	0.95
40_G	53_V	0.632	0.95
72_L	75_N	0.630	0.95
18_V	21_I	0.624	0.94
53_V	63_G	0.621	0.94
18_V	24_V	0.616	0.94
75_N	81_G	0.615	0.94
25_I	29_F	0.611	0.94
26_V	31_A	0.608	0.94
69_L	72_L	0.601	0.93
71_F	74_S	0.593	0.93
9_F	19_L	0.580	0.92
62_D	65_V	0.577	0.92
17_K	89_G	0.572	0.91
59_T	63_G	0.571	0.91
76_L	80_G	0.571	0.91
58_D	67_A	0.570	0.91
47_D	52_A	0.555	0.90
57_L	61_G	0.546	0.90
19_L	78_F	0.543	0.89
7_I	30_F	0.532	0.88
71_F	81_G	0.517	0.87
24_V	28_L	0.516	0.87
46_W	50_E	0.514	0.87
8_G	12_G	0.514	0.87
86_F	90_F	0.513	0.86
15_L	52_A	0.512	0.86
28_L	52_A	0.510	0.86
13_Y	21_I	0.510	0.86
20_K	80_G	0.505	0.86
9_F	88_L	0.503	0.85
48_K	51_S	0.502	0.85
5_F	77_P	0.501	0.85
3_G	30_F	0.500	0.85

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3qnqA	2	0.8778	3.6	0.886	Contact Map
4od4A	1	0.9333	3.3	0.888	Contact Map
4tq3A	1	0.9444	2.9	0.892	Contact Map
4citA	1	0.3	2.8	0.892	Contact Map
4fc4A	3	0.4111	2.5	0.896	Contact Map
4ymuD	2	0.4667	2.4	0.896	Contact Map
3kd6A	2	0.6	1.8	0.904	Contact Map
3tdsE	3	0.4333	1.8	0.904	Contact Map
2nq2A	2	0.6556	1.8	0.904	Contact Map
2pkfA	2	0.7111	1.7	0.904	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.