HK97-gp10_like - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HK97-gp10_like - Bacteriophage HK97-gp10, putative tail-component

PFAM:	PF04883	Sequences: DELLKKLKKLPKKEVRKAVRKALRAAAEVVLAEAKANAPSVDTTGRLRRSITVSKKVKKKGGGLTVEVGNNAEYAHYVEFG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	81 (76)
Sequences:	13245 (11315)
Seq/√Len:	1298.0
META:	0.88

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
31_L	53_V	2.874	1.00
31_L	35_K	2.629	1.00
27_A	66_V	2.587	1.00
33_E	37_N	2.543	1.00
41_V	48_R	2.305	1.00
38_A	51_I	2.017	1.00
31_L	51_I	1.930	1.00
24_R	53_V	1.926	1.00
28_E	53_V	1.916	1.00
26_A	29_V	1.877	1.00
39_P	48_R	1.634	1.00
47_L	75_A	1.619	1.00
22_A	26_A	1.570	1.00
28_E	31_L	1.561	1.00
4_L	8_K	1.560	1.00
15_V	18_A	1.542	1.00
34_A	51_I	1.509	1.00
46_R	72_A	1.464	1.00
76_H	80_F	1.457	1.00
51_I	70_N	1.447	1.00
27_A	53_V	1.420	1.00
47_L	78_V	1.391	1.00
33_E	36_A	1.390	1.00
46_R	49_R	1.390	1.00
43_T	46_R	1.330	1.00
6_K	9_K	1.308	1.00
46_R	50_S	1.307	1.00
11_P	14_E	1.243	1.00
30_V	34_A	1.223	1.00
38_A	47_L	1.201	1.00
34_A	38_A	1.197	1.00
74_Y	77_Y	1.169	1.00
73_E	77_Y	1.149	1.00
23_L	66_V	1.134	1.00
34_A	37_N	1.118	1.00
26_A	30_V	1.112	1.00
11_P	16_R	1.105	1.00
14_E	18_A	1.096	1.00
52_T	69_G	1.082	1.00
25_A	29_V	1.077	1.00
18_A	22_A	1.068	1.00
29_V	33_E	1.056	1.00
23_L	27_A	1.039	1.00
70_N	75_A	1.030	1.00
11_P	15_V	1.030	1.00
24_R	28_E	1.025	1.00
74_Y	78_V	0.943	1.00
38_A	78_V	0.940	1.00
46_R	74_Y	0.875	1.00
20_R	64_L	0.873	1.00
6_K	11_P	0.869	1.00
39_P	78_V	0.865	1.00
60_K	63_G	0.857	1.00
22_A	25_A	0.849	1.00
45_G	48_R	0.843	1.00
70_N	73_E	0.836	1.00
35_K	48_R	0.809	1.00
24_R	66_V	0.804	1.00
30_V	68_V	0.800	1.00
15_V	19_V	0.798	1.00
19_V	22_A	0.797	1.00
69_G	72_A	0.774	1.00
58_K	61_G	0.769	1.00
28_E	32_A	0.748	1.00
18_A	21_K	0.724	1.00
5_K	8_K	0.721	1.00
38_A	48_R	0.718	1.00
20_R	66_V	0.716	1.00
30_V	33_E	0.707	1.00
3_L	7_L	0.696	1.00
2_E	6_K	0.689	1.00
55_K	58_K	0.676	1.00
47_L	50_S	0.672	1.00
19_V	64_L	0.657	1.00
45_G	49_R	0.651	1.00
73_E	76_H	0.646	1.00
10_L	15_V	0.644	1.00
16_R	64_L	0.641	1.00
37_N	79_E	0.637	1.00
50_S	72_A	0.629	1.00
32_A	35_K	0.617	1.00
20_R	24_R	0.616	1.00
50_S	70_N	0.615	1.00
12_K	16_R	0.615	1.00
34_A	70_N	0.611	1.00
67_E	70_N	0.611	1.00
56_K	59_K	0.604	1.00
12_K	17_K	0.604	1.00
35_K	51_I	0.603	1.00
29_V	32_A	0.601	1.00
42_D	46_R	0.600	1.00
5_K	9_K	0.600	1.00
6_K	10_L	0.596	1.00
77_Y	80_F	0.596	1.00
23_L	26_A	0.591	1.00
32_A	36_A	0.590	1.00
65_T	68_V	0.577	1.00
50_S	71_N	0.576	1.00
58_K	63_G	0.570	1.00
53_V	66_V	0.567	1.00
57_V	60_K	0.564	1.00
14_E	17_K	0.562	1.00
17_K	21_K	0.556	1.00
16_R	20_R	0.554	1.00
28_E	49_R	0.545	1.00
50_S	75_A	0.544	1.00
31_L	52_T	0.541	1.00
56_K	63_G	0.541	1.00
12_K	15_V	0.540	1.00
4_L	11_P	0.532	1.00
19_V	23_L	0.515	1.00
42_D	45_G	0.514	1.00
39_P	42_D	0.508	1.00
47_L	74_Y	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3lnuA	1	0.3457	10.4	0.834	Contact Map
1s16A	2	0.3951	8	0.842	Contact Map
3lk4B	1	0.4198	6.6	0.848	Contact Map
3zkbA	5	0.4321	6.2	0.849	Contact Map
4urlA	1	0.4815	5.8	0.852	Contact Map
1kijA	2	0.4568	5.4	0.854	Contact Map
4wubA	2	0.4568	5.1	0.855	Contact Map
2zciA	2	0.3704	5	0.856	Contact Map
3m9dG	1	0.1852	4.6	0.859	Contact Map
2p4sA	3	0.358	4.6	0.859	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.