Ovate - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Ovate - Transcriptional repressor, ovate

PFAM:	PF04844	Sequences: SEDPYEDFRRSMVEMIVENGIRDWEDLEELLACYLSLNSKEHHGVIVGAFVDLWVDLF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	58 (57)
Sequences:	790 (373)
Seq/√Len:	49.3
META:	0.089

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
33_C	37_L	3.396	1.00
1_S	7_D	3.347	1.00
12_M	35_L	2.414	1.00
26_D	30_L	2.344	1.00
8_F	31_L	2.023	1.00
12_M	31_L	1.904	0.99
22_R	34_Y	1.897	0.99
3_D	6_E	1.834	0.99
28_E	33_C	1.541	0.97
28_E	32_A	1.508	0.97
30_L	37_L	1.498	0.96
44_G	48_G	1.431	0.95
6_E	47_V	1.423	0.95
34_Y	41_E	1.392	0.95
14_E	34_Y	1.371	0.94
25_E	44_G	1.358	0.94
40_K	49_A	1.336	0.93
5_Y	52_D	1.335	0.93
31_L	35_L	1.269	0.91
24_W	53_L	1.199	0.89
15_M	43_H	1.151	0.87
8_F	11_S	1.120	0.85
46_I	50_F	1.095	0.84
32_A	47_V	1.074	0.83
6_E	23_D	1.060	0.82
18_E	21_I	1.059	0.82
8_F	12_M	1.057	0.82
30_L	33_C	1.052	0.81
15_M	30_L	1.030	0.80
48_G	55_V	0.997	0.78
7_D	11_S	0.986	0.77
13_V	21_I	0.975	0.76
22_R	57_L	0.933	0.73
10_R	34_Y	0.903	0.70
1_S	4_P	0.893	0.69
23_D	53_L	0.887	0.69
6_E	44_G	0.868	0.67
10_R	56_D	0.860	0.67
12_M	54_W	0.847	0.65
12_M	52_D	0.837	0.64
33_C	47_V	0.836	0.64
27_L	31_L	0.833	0.64
10_R	17_V	0.830	0.64
28_E	42_H	0.806	0.61
42_H	45_V	0.806	0.61
6_E	10_R	0.797	0.61
49_A	56_D	0.797	0.61
36_S	51_V	0.796	0.60
2_E	17_V	0.786	0.60
5_Y	51_V	0.783	0.59
14_E	33_C	0.744	0.55
2_E	23_D	0.721	0.53
35_L	47_V	0.713	0.52
14_E	28_E	0.709	0.52
24_W	48_G	0.708	0.52
16_I	48_G	0.705	0.51
29_E	44_G	0.704	0.51
28_E	51_V	0.700	0.51
5_Y	43_H	0.684	0.49
6_E	29_E	0.682	0.49
45_V	49_A	0.678	0.49
35_L	43_H	0.677	0.49
2_E	45_V	0.666	0.47
8_F	46_I	0.664	0.47
17_V	45_V	0.644	0.45
18_E	26_D	0.642	0.45
32_A	40_K	0.637	0.44
24_W	55_V	0.633	0.44
45_V	48_G	0.633	0.44
21_I	54_W	0.632	0.44
16_I	54_W	0.628	0.44
1_S	15_M	0.616	0.42
10_R	23_D	0.602	0.41
31_L	52_D	0.600	0.41
1_S	5_Y	0.598	0.41
34_Y	53_L	0.581	0.39
8_F	35_L	0.560	0.37
20_G	24_W	0.546	0.36
18_E	23_D	0.533	0.34
23_D	40_K	0.533	0.34
11_S	38_N	0.521	0.33
13_V	55_V	0.521	0.33
22_R	26_D	0.509	0.32
14_E	41_E	0.504	0.32
29_E	37_L	0.501	0.32
17_V	48_G	0.500	0.31

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ionA	1	0.931	44.4	0.857	Contact Map
2nszA	1	0.931	43.1	0.858	Contact Map
2zu6B	1	0.9655	33.7	0.865	Contact Map
2rg8A	1	0.9655	29.8	0.869	Contact Map
1ug3A	1	0.9655	26.8	0.872	Contact Map
3eiqC	1	0.9655	23.7	0.875	Contact Map
2xwvA	1	0.7241	22	0.878	Contact Map
3l6aA	1	0.9138	16.9	0.884	Contact Map
1ji6A	1	1	12.1	0.891	Contact Map
4bzjA	2	0.8621	7.5	0.901	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0039 seconds.