DUF547 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF547 - Protein of unknown function, DUF547

PFAM:	PF04784	Sequences: PSSLSRDEQLAFWINAYNALTIKLILDSHWKRIGFFDKKFITVGGKTLSLDDIEHGILRPNALALDFKDPRIHFALNCASISCPPLRAYTAENLDAQLDDAAREFL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	106 (99)
Sequences:	15047 (10049)
Seq/√Len:	1010.0
META:	0.901

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
78_C	83_C	2.789	1.00
93_N	97_Q	2.522	1.00
74_F	102_A	2.485	1.00
90_T	93_N	2.435	1.00
52_D	56_G	2.306	1.00
55_H	59_R	2.278	1.00
23_K	27_D	2.187	1.00
37_D	51_D	2.066	1.00
42_T	47_T	2.034	1.00
20_L	41_I	1.958	1.00
8_E	91_A	1.906	1.00
87_R	101_A	1.884	1.00
74_F	105_F	1.878	1.00
87_R	100_D	1.765	1.00
85_P	104_E	1.707	1.00
75_A	89_Y	1.672	1.00
99_D	103_R	1.672	1.00
58_L	76_L	1.613	1.00
10_L	14_I	1.581	1.00
5_S	8_E	1.555	1.00
11_A	91_A	1.538	1.00
21_T	50_L	1.535	1.00
10_L	72_I	1.431	1.00
6_R	10_L	1.412	1.00
13_W	53_I	1.385	1.00
33_I	36_F	1.373	1.00
16_A	20_L	1.366	1.00
10_L	69_D	1.365	1.00
75_A	98_L	1.361	1.00
100_D	104_E	1.330	1.00
14_I	75_A	1.325	1.00
10_L	58_L	1.303	1.00
48_L	52_D	1.282	1.00
93_N	96_A	1.279	1.00
7_D	95_D	1.279	1.00
71_R	99_D	1.268	1.00
87_R	97_Q	1.255	1.00
30_W	33_I	1.239	1.00
61_N	67_F	1.198	1.00
89_Y	97_Q	1.197	1.00
89_Y	101_A	1.172	1.00
71_R	95_D	1.157	1.00
21_T	79_A	1.149	1.00
32_R	35_F	1.141	1.00
10_L	94_L	1.135	1.00
54_E	78_C	1.120	1.00
101_A	104_E	1.099	1.00
90_T	97_Q	1.098	1.00
24_L	35_F	1.093	1.00
24_L	41_I	1.090	1.00
48_L	57_I	1.064	1.00
51_D	55_H	1.051	1.00
31_K	35_F	1.033	1.00
46_K	57_I	1.030	1.00
13_W	57_I	1.013	1.00
14_I	76_L	1.005	1.00
17_Y	78_C	0.986	1.00
96_A	100_D	0.984	1.00
77_N	83_C	0.982	1.00
6_R	9_Q	0.970	1.00
94_L	97_Q	0.961	1.00
95_D	99_D	0.941	1.00
49_S	52_D	0.933	1.00
7_D	10_L	0.923	1.00
14_I	89_Y	0.919	1.00
20_L	40_F	0.911	1.00
60_P	68_K	0.901	1.00
20_L	43_V	0.871	1.00
87_R	104_E	0.869	1.00
39_K	49_S	0.859	1.00
20_L	23_K	0.858	1.00
24_L	40_F	0.834	1.00
44_G	48_L	0.832	1.00
20_L	24_L	0.825	1.00
25_I	79_A	0.811	1.00
32_R	36_F	0.808	1.00
9_Q	61_N	0.803	1.00
30_W	35_F	0.797	1.00
42_T	45_G	0.797	1.00
97_Q	101_A	0.789	1.00
24_L	36_F	0.767	1.00
80_S	83_C	0.762	1.00
72_I	76_L	0.753	1.00
19_A	22_I	0.751	1.00
31_K	36_F	0.744	1.00
4_L	44_G	0.743	1.00
99_D	102_A	0.740	1.00
4_L	8_E	0.739	1.00
71_R	75_A	0.737	1.00
16_A	41_I	0.735	1.00
52_D	57_I	0.727	1.00
40_F	47_T	0.715	1.00
58_L	72_I	0.713	1.00
22_I	86_L	0.711	1.00
9_Q	67_F	0.705	1.00
24_L	39_K	0.699	1.00
22_I	25_I	0.696	1.00
48_L	53_I	0.695	1.00
61_N	68_K	0.687	1.00
30_W	36_F	0.686	1.00
56_G	60_P	0.684	1.00
13_W	48_L	0.683	1.00
23_K	41_I	0.676	1.00
81_I	85_P	0.664	1.00
21_T	36_F	0.655	1.00
94_L	98_L	0.651	1.00
21_T	35_F	0.648	1.00
73_H	77_N	0.643	1.00
75_A	101_A	0.641	1.00
16_A	53_I	0.640	1.00
19_A	26_L	0.640	1.00
43_V	48_L	0.639	1.00
20_L	53_I	0.633	1.00
13_W	43_V	0.628	1.00
57_I	61_N	0.627	1.00
74_F	106_L	0.624	1.00
40_F	49_S	0.614	1.00
30_W	34_G	0.611	1.00
31_K	34_G	0.597	1.00
21_T	25_I	0.593	1.00
14_I	98_L	0.592	1.00
14_I	94_L	0.588	1.00
78_C	84_P	0.579	1.00
70_P	102_A	0.572	1.00
12_F	44_G	0.570	1.00
23_K	26_L	0.569	1.00
22_I	26_L	0.568	1.00
37_D	49_S	0.567	1.00
60_P	67_F	0.560	1.00
73_H	78_C	0.560	1.00
29_H	33_I	0.544	1.00
71_R	98_L	0.542	1.00
9_Q	13_W	0.534	1.00
57_I	60_P	0.533	1.00
24_L	38_K	0.532	1.00
17_Y	54_E	0.531	1.00
39_K	42_T	0.530	1.00
14_I	18_N	0.521	1.00
19_A	23_K	0.519	1.00
53_I	58_L	0.518	1.00
75_A	94_L	0.517	1.00
77_N	86_L	0.511	1.00
85_P	101_A	0.510	1.00
54_E	83_C	0.506	1.00
39_K	47_T	0.504	1.00
4_L	12_F	0.501	1.00
12_F	43_V	0.500	1.00
38_K	42_T	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3laxA	1	0.6226	22.6	0.891	Contact Map
4rh7A	1	0.9623	12.7	0.903	Contact Map
4s2rP	2	0.3774	12.5	0.903	Contact Map
3ctzA	2	0.3774	12	0.904	Contact Map
4d4iA	1	0.8868	9.3	0.909	Contact Map
4h62V	1	0.1604	6.9	0.914	Contact Map
3bb7A	1	0.5189	6.9	0.914	Contact Map
4rvnA	3	0.934	6.6	0.915	Contact Map
3izxA	3	0.934	5.8	0.917	Contact Map
3cs5A	2	0.3302	5.8	0.917	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.