OST3_OST6 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

OST3_OST6 - OST3 / OST6 family

PFAM:	PF04756	Sequences: AEFISERTGVQIPIKRPPNYSKTIALTLLLVLGGGLLYLVRNPLIFPILQNRNLWAAGSLIVILLFTSGQMFNHIRGPPYVAGDQDGGISYFAGGSQNQFGAETQIVAALYGLLALGLILLTEAVPRIKDPKKQRIAVIVWLALIFVFFSFL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	152 (149)
Sequences:	655 (512)
Seq/√Len:	42.0
META:	0.243

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
82_A	100_F	4.009	1.00
72_F	78_P	3.182	1.00
62_V	66_F	3.171	1.00
84_D	88_G	3.004	1.00
80_Y	105_Q	2.994	1.00
93_A	100_F	2.906	1.00
27_T	31_V	2.734	1.00
25_A	29_L	2.718	1.00
78_P	101_G	2.679	1.00
91_Y	106_I	2.551	1.00
71_M	76_R	2.459	1.00
18_P	24_I	2.400	1.00
73_N	104_T	2.301	1.00
70_Q	73_N	2.214	1.00
135_R	139_I	2.179	1.00
63_I	67_T	2.141	0.99
71_M	75_I	2.128	0.99
71_M	111_Y	2.048	0.99
4_I	8_T	2.012	0.99
63_I	104_T	1.999	0.99
34_G	113_L	1.980	0.99
65_L	70_Q	1.883	0.99
99_Q	103_E	1.832	0.98
72_F	104_T	1.805	0.98
118_L	145_I	1.802	0.98
74_H	91_Y	1.799	0.98
64_L	109_A	1.766	0.98
138_V	148_F	1.744	0.98
14_I	102_A	1.583	0.96
110_L	148_F	1.499	0.94
6_E	9_G	1.440	0.93
73_N	78_P	1.407	0.92
66_F	71_M	1.397	0.92
32_L	35_G	1.396	0.92
58_G	62_V	1.260	0.87
5_S	10_V	1.241	0.86
52_R	70_Q	1.225	0.85
66_F	104_T	1.220	0.85
109_A	113_L	1.215	0.85
139_I	146_F	1.203	0.84
35_G	40_V	1.202	0.84
20_Y	25_A	1.199	0.84
81_V	101_G	1.191	0.84
37_L	46_F	1.191	0.84
5_S	8_T	1.189	0.84
38_Y	144_L	1.172	0.83
38_Y	42_N	1.172	0.83
37_L	40_V	1.165	0.82
66_F	72_F	1.165	0.82
101_G	111_Y	1.162	0.82
30_L	34_G	1.150	0.82
20_Y	56_A	1.147	0.81
70_Q	104_T	1.141	0.81
109_A	116_L	1.125	0.80
28_L	32_L	1.115	0.80
90_S	100_F	1.098	0.79
137_A	141_W	1.096	0.78
39_L	92_F	1.093	0.78
100_F	115_A	1.093	0.78
94_G	123_E	1.086	0.78
90_S	94_G	1.075	0.77
66_F	105_Q	1.071	0.77
33_G	38_Y	1.058	0.76
21_S	107_V	1.048	0.75
13_P	106_I	1.041	0.75
82_A	90_S	1.038	0.74
81_V	102_A	1.037	0.74
7_R	39_L	1.034	0.74
92_F	111_Y	1.032	0.74
78_P	84_D	1.030	0.74
2_E	5_S	1.025	0.74
128_I	134_Q	1.015	0.73
5_S	11_Q	1.003	0.72
54_L	58_G	1.000	0.72
30_L	57_A	0.997	0.71
71_M	104_T	0.978	0.70
16_R	73_N	0.964	0.69
130_D	143_A	0.963	0.69
82_A	108_A	0.956	0.68
120_L	147_V	0.952	0.68
66_F	111_Y	0.942	0.67
37_L	77_G	0.941	0.67
8_T	11_Q	0.937	0.67
32_L	51_N	0.936	0.67
26_L	145_I	0.931	0.66
142_L	145_I	0.930	0.66
139_I	144_L	0.928	0.66
82_A	96_S	0.922	0.65
30_L	113_L	0.922	0.65
102_A	137_A	0.920	0.65
60_L	128_I	0.920	0.65
24_I	37_L	0.917	0.65
31_V	138_V	0.911	0.64
92_F	106_I	0.909	0.64
69_G	103_E	0.880	0.62
71_M	105_Q	0.879	0.62
54_L	81_V	0.878	0.62
26_L	32_L	0.876	0.61
56_A	60_L	0.870	0.61
3_F	52_R	0.869	0.61
66_F	108_A	0.866	0.60
137_A	140_V	0.861	0.60
76_R	111_Y	0.858	0.60
113_L	148_F	0.858	0.60
40_V	44_L	0.856	0.60
119_I	124_A	0.842	0.58
4_I	21_S	0.841	0.58
82_A	102_A	0.816	0.56
56_A	108_A	0.815	0.56
55_W	76_R	0.812	0.55
66_F	96_S	0.807	0.55
111_Y	114_L	0.804	0.55
93_A	96_S	0.803	0.55
52_R	71_M	0.800	0.54
82_A	94_G	0.800	0.54
136_I	144_L	0.790	0.53
31_V	58_G	0.781	0.53
64_L	112_G	0.778	0.52
112_G	115_A	0.766	0.51
2_E	6_E	0.765	0.51
142_L	146_F	0.761	0.51
79_P	101_G	0.756	0.50
71_M	95_G	0.754	0.50
140_V	143_A	0.751	0.50
111_Y	121_L	0.745	0.49
41_R	107_V	0.731	0.48
108_A	115_A	0.730	0.48
98_N	130_D	0.725	0.47
117_G	123_E	0.725	0.47
105_Q	112_G	0.717	0.47
130_D	135_R	0.715	0.46
90_S	93_A	0.713	0.46
31_V	62_V	0.709	0.46
63_I	111_Y	0.707	0.46
62_V	77_G	0.705	0.45
118_L	122_T	0.704	0.45
59_S	63_I	0.703	0.45
101_G	145_I	0.702	0.45
3_F	135_R	0.701	0.45
84_D	102_A	0.697	0.45
64_L	67_T	0.695	0.45
92_F	138_V	0.695	0.45
66_F	109_A	0.690	0.44
66_F	70_Q	0.687	0.44
139_I	143_A	0.687	0.44
117_G	141_W	0.685	0.44
17_P	68_S	0.680	0.43
56_A	63_I	0.673	0.43
4_I	7_R	0.670	0.42
61_I	116_L	0.669	0.42
31_V	54_L	0.666	0.42
31_V	143_A	0.663	0.42
9_G	12_I	0.657	0.41
76_R	97_Q	0.651	0.41
53_N	56_A	0.650	0.40
42_N	46_F	0.649	0.40
71_M	97_Q	0.648	0.40
128_I	140_V	0.648	0.40
133_K	142_L	0.648	0.40
40_V	43_P	0.645	0.40
30_L	58_G	0.643	0.40
93_A	98_N	0.641	0.40
60_L	151_F	0.638	0.39
69_G	99_Q	0.632	0.39
21_S	24_I	0.620	0.38
62_V	140_V	0.620	0.38
107_V	111_Y	0.618	0.38
116_L	148_F	0.618	0.38
53_N	139_I	0.611	0.37
92_F	147_V	0.610	0.37
7_R	10_V	0.605	0.36
115_A	119_I	0.604	0.36
101_G	105_Q	0.604	0.36
21_S	54_L	0.604	0.36
25_A	97_Q	0.604	0.36
17_P	71_M	0.602	0.36
45_I	148_F	0.601	0.36
71_M	101_G	0.597	0.36
68_S	71_M	0.595	0.36
100_F	110_L	0.593	0.35
104_T	112_G	0.584	0.35
33_G	113_L	0.583	0.35
71_M	114_L	0.583	0.35
65_L	128_I	0.570	0.33
82_A	89_I	0.567	0.33
132_K	142_L	0.562	0.33
26_L	107_V	0.560	0.33
37_L	44_L	0.560	0.33
92_F	107_V	0.558	0.32
144_L	148_F	0.558	0.32
81_V	115_A	0.554	0.32
34_G	136_I	0.552	0.32
27_T	34_G	0.550	0.32
143_A	146_F	0.547	0.32
33_G	61_I	0.546	0.31
141_W	145_I	0.546	0.31
62_V	65_L	0.544	0.31
45_I	51_N	0.542	0.31
6_E	38_Y	0.542	0.31
77_G	107_V	0.541	0.31
19_N	74_H	0.539	0.31
29_L	146_F	0.534	0.30
71_M	98_N	0.532	0.30
89_I	102_A	0.531	0.30
10_V	21_S	0.530	0.30
76_R	107_V	0.530	0.30
32_L	136_I	0.529	0.30
11_Q	22_K	0.529	0.30
3_F	6_E	0.527	0.30
31_V	131_P	0.526	0.30
26_L	30_L	0.522	0.30
76_R	121_L	0.522	0.30
38_Y	44_L	0.521	0.29
30_L	144_L	0.516	0.29
63_I	105_Q	0.515	0.29
142_L	149_F	0.510	0.29
18_P	26_L	0.509	0.29
92_F	126_P	0.508	0.28
107_V	128_I	0.506	0.28
113_L	127_R	0.506	0.28
17_P	55_W	0.503	0.28
90_S	108_A	0.503	0.28
104_T	111_Y	0.502	0.28
115_A	129_K	0.500	0.28

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4h33A	3	0.5	11.8	0.926	Contact Map
4qi1A	3	0.3026	6.6	0.934	Contact Map
1lnqA	6	0.4737	5.4	0.937	Contact Map
2jafA	3	0.3684	5	0.938	Contact Map
4qinA	2	0.5066	4.4	0.94	Contact Map
4fbzA	3	0.375	4	0.94	Contact Map
4l35A	3	0.3487	3.8	0.941	Contact Map
4m64A	1	0.8618	3.5	0.942	Contact Map
4xtlA	1	0.4408	3.4	0.942	Contact Map
3dl8G	1	0.5658	3.2	0.943	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.