PLAC8 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PLAC8 - PLAC8 family

PFAM:	PF04749	Sequences: WSTGLFDCFSDCGTCCLGCFCPCVTFGQNAERLGCLLTGCGCIYSCALRTKIREKYGIPGSPCGDCLVHCCCPPCALCQEARE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	83 (82)
Sequences:	3584 (2703)
Seq/√Len:	298.5
META:	0.445

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
53_R	65_D	3.650	1.00
67_L	71_C	2.960	1.00
18_G	25_T	2.641	1.00
5_L	68_V	2.594	1.00
18_G	78_C	2.574	1.00
16_C	20_F	2.526	1.00
49_R	79_Q	2.229	1.00
45_S	69_H	2.177	1.00
52_I	80_E	2.161	1.00
68_V	76_A	1.895	1.00
69_H	80_E	1.784	1.00
74_P	78_C	1.761	1.00
30_A	34_G	1.647	1.00
76_A	80_E	1.606	1.00
3_T	82_R	1.498	1.00
60_G	65_D	1.463	1.00
69_H	76_A	1.384	1.00
24_V	28_Q	1.361	1.00
9_F	12_C	1.333	1.00
53_R	60_G	1.322	1.00
45_S	80_E	1.303	1.00
61_S	64_G	1.293	1.00
29_N	80_E	1.282	1.00
51_K	55_K	1.281	1.00
4_G	7_D	1.253	1.00
29_N	81_A	1.210	1.00
66_C	70_C	1.210	1.00
25_T	29_N	1.190	1.00
78_C	82_R	1.144	1.00
17_L	28_Q	1.136	1.00
3_T	83_E	1.132	1.00
14_T	17_L	1.118	1.00
3_T	10_S	1.105	1.00
17_L	25_T	1.097	1.00
28_Q	32_R	1.094	1.00
46_C	62_P	1.090	1.00
72_C	75_C	1.064	1.00
27_G	31_E	1.058	1.00
11_D	14_T	1.050	1.00
14_T	81_A	1.047	1.00
47_A	50_T	1.035	1.00
64_G	68_V	1.027	1.00
11_D	82_R	1.015	1.00
7_D	10_S	1.002	1.00
25_T	81_A	0.996	1.00
47_A	51_K	0.990	1.00
30_A	48_L	0.986	1.00
45_S	73_P	0.972	1.00
24_V	27_G	0.971	1.00
17_L	24_V	0.959	1.00
29_N	33_L	0.928	1.00
14_T	78_C	0.917	1.00
17_L	21_C	0.910	1.00
27_G	30_A	0.900	1.00
26_F	29_N	0.896	1.00
1_W	80_E	0.860	1.00
39_G	42_C	0.851	1.00
45_S	76_A	0.847	1.00
50_T	62_P	0.837	1.00
1_W	58_I	0.835	1.00
40_C	43_I	0.834	1.00
64_G	67_L	0.834	1.00
48_L	80_E	0.834	1.00
29_N	32_R	0.829	1.00
27_G	32_R	0.810	1.00
26_F	77_L	0.804	1.00
50_T	54_E	0.788	0.99
70_C	73_P	0.777	0.99
26_F	48_L	0.767	0.99
2_S	83_E	0.767	0.99
3_T	78_C	0.745	0.99
15_C	19_C	0.744	0.99
48_L	51_K	0.740	0.99
58_I	62_P	0.739	0.99
46_C	66_C	0.738	0.99
77_L	80_E	0.738	0.99
8_C	75_C	0.733	0.99
29_N	77_L	0.728	0.99
76_A	79_Q	0.728	0.99
28_Q	81_A	0.718	0.99
46_C	50_T	0.708	0.99
62_P	66_C	0.700	0.99
56_Y	83_E	0.695	0.99
20_F	23_C	0.691	0.99
11_D	15_C	0.685	0.99
21_C	24_V	0.684	0.99
3_T	14_T	0.677	0.98
32_R	81_A	0.670	0.98
46_C	69_H	0.666	0.98
10_S	14_T	0.665	0.98
63_C	67_L	0.652	0.98
3_T	7_D	0.643	0.98
57_G	83_E	0.626	0.97
23_C	27_G	0.615	0.97
10_S	82_R	0.613	0.97
26_F	44_Y	0.592	0.96
25_T	30_A	0.585	0.96
16_C	19_C	0.578	0.96
14_T	18_G	0.569	0.95
68_V	72_C	0.569	0.95
12_C	16_C	0.568	0.95
26_F	30_A	0.568	0.95
33_L	51_K	0.564	0.95
54_E	62_P	0.559	0.95
25_T	28_Q	0.557	0.95
47_A	62_P	0.550	0.94
19_C	74_P	0.548	0.94
45_S	77_L	0.544	0.94
60_G	64_G	0.541	0.94
56_Y	59_P	0.535	0.94
41_G	44_Y	0.535	0.94
48_L	62_P	0.534	0.94
18_G	77_L	0.533	0.94
13_G	17_L	0.527	0.93
49_R	52_I	0.525	0.93
9_F	36_L	0.522	0.93
19_C	22_P	0.519	0.93
2_S	14_T	0.511	0.92
53_R	58_I	0.511	0.92
39_G	70_C	0.511	0.92
44_Y	48_L	0.505	0.92
39_G	43_I	0.500	0.91
1_W	53_R	0.500	0.91

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1a8lA	2	0.5181	2.4	0.909	Contact Map
2c31A	4	0.6024	1.3	0.921	Contact Map
2ywmA	3	0.506	1	0.926	Contact Map
2q28A	4	0.6024	1	0.927	Contact Map
3nznA	4	0.5181	1	0.928	Contact Map
1fs1B	2	0.6386	0.9	0.929	Contact Map
4i6xA	1	0.506	0.9	0.93	Contact Map
2ihtA	4	0.5542	0.8	0.93	Contact Map
1q6zA	4	0.5542	0.8	0.932	Contact Map
2co5A	2	0.3976	0.8	0.932	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.