ELMO_CED12 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ELMO_CED12 - ELMO/CED-12 family

PFAM:	PF04727	Sequences: HLLEKRRKVPFDSENPEHERALKELWKALFPDEELPSRISEQWKELGFQGEDPATDFRGMGFLGLENLLYFARNYPDSFQKLLLEQSHRPAEWEYPFAVAGINITFMLYELLRLGALKPECNSLLAFDELYCAAFQLFDRLWKEMGATYMDFNKVL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	156 (153)
Sequences:	1113 (756)
Seq/√Len:	61.1
META:	0.265

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
101_G	131_Y	5.989	1.00
50_G	55_T	4.760	1.00
24_E	73_R	4.521	1.00
95_Y	139_D	3.759	1.00
60_M	64_G	3.192	1.00
67_N	105_T	2.865	1.00
49_Q	56_D	2.821	1.00
64_G	102_I	2.785	1.00
67_N	128_D	2.619	1.00
85_E	139_D	2.510	1.00
19_E	38_R	2.406	1.00
67_N	127_F	2.400	1.00
49_Q	58_R	2.378	1.00
67_N	131_Y	2.309	1.00
70_Y	129_E	2.213	1.00
49_Q	55_T	2.169	1.00
29_L	79_F	2.096	1.00
6_R	66_E	2.054	1.00
70_Y	132_C	1.908	1.00
49_Q	103_N	1.837	1.00
108_L	127_F	1.813	1.00
63_L	127_F	1.795	1.00
101_G	135_F	1.782	0.99
21_A	66_E	1.762	0.99
57_F	65_L	1.668	0.99
55_T	58_R	1.580	0.99
50_G	56_D	1.479	0.98
15_N	22_L	1.449	0.98
57_F	102_I	1.445	0.98
24_E	28_A	1.428	0.98
63_L	105_T	1.419	0.97
68_L	98_A	1.410	0.97
151_D	154_K	1.397	0.97
24_E	69_L	1.366	0.97
96_P	100_A	1.341	0.96
108_L	130_L	1.321	0.96
105_T	131_Y	1.287	0.95
148_T	151_D	1.286	0.95
125_L	129_E	1.263	0.95
99_V	103_N	1.263	0.95
49_Q	59_G	1.259	0.95
98_A	102_I	1.243	0.94
53_P	56_D	1.238	0.94
98_A	105_T	1.218	0.94
71_F	79_F	1.206	0.94
71_F	132_C	1.186	0.93
4_E	7_R	1.179	0.93
61_G	64_G	1.175	0.93
58_R	61_G	1.170	0.92
72_A	79_F	1.167	0.92
48_F	102_I	1.163	0.92
29_L	46_L	1.138	0.91
60_M	106_F	1.134	0.91
60_M	102_I	1.128	0.91
22_L	38_R	1.127	0.91
147_A	151_D	1.115	0.91
63_L	67_N	1.113	0.90
88_H	91_A	1.068	0.89
12_D	15_N	1.065	0.88
137_L	141_L	1.054	0.88
63_L	138_F	1.054	0.88
50_G	59_G	1.054	0.88
41_E	51_E	1.048	0.88
100_A	138_F	1.045	0.87
29_L	97_F	1.042	0.87
58_R	103_N	1.036	0.87
11_F	19_E	1.036	0.87
69_L	73_R	1.010	0.86
7_R	109_Y	1.004	0.85
10_P	16_P	1.003	0.85
85_E	95_Y	1.003	0.85
26_W	43_W	1.001	0.85
27_K	32_D	0.984	0.84
96_P	147_A	0.975	0.84
55_T	59_G	0.973	0.83
21_A	69_L	0.961	0.83
49_Q	102_I	0.958	0.82
35_L	42_Q	0.948	0.82
56_D	103_N	0.947	0.82
17_E	51_E	0.944	0.81
41_E	44_K	0.937	0.81
22_L	65_L	0.936	0.81
38_R	52_D	0.926	0.80
76_P	80_Q	0.922	0.80
11_F	18_H	0.904	0.79
11_F	57_F	0.892	0.78
68_L	101_G	0.890	0.77
128_D	131_Y	0.888	0.77
104_I	155_V	0.887	0.77
131_Y	135_F	0.887	0.77
55_T	150_M	0.883	0.77
86_Q	95_Y	0.882	0.77
49_Q	99_V	0.882	0.77
83_L	86_Q	0.875	0.76
104_I	139_D	0.866	0.76
21_A	62_F	0.862	0.75
31_P	35_L	0.846	0.74
62_F	65_L	0.846	0.74
105_T	127_F	0.838	0.73
95_Y	101_G	0.836	0.73
141_L	155_V	0.832	0.73
33_E	144_E	0.826	0.72
107_M	153_N	0.807	0.70
117_L	121_C	0.799	0.69
22_L	43_W	0.796	0.69
112_L	115_G	0.795	0.69
140_R	144_E	0.792	0.69
96_P	126_A	0.791	0.69
85_E	88_H	0.790	0.69
25_L	36_P	0.788	0.68
28_A	73_R	0.784	0.68
13_S	38_R	0.782	0.68
83_L	100_A	0.781	0.68
81_K	85_E	0.773	0.67
75_Y	95_Y	0.769	0.67
49_Q	53_P	0.769	0.67
9_V	62_F	0.766	0.66
110_E	153_N	0.762	0.66
40_S	50_G	0.754	0.65
105_T	144_E	0.753	0.65
23_K	27_K	0.734	0.63
6_R	45_E	0.733	0.63
70_Y	74_N	0.731	0.63
64_G	109_Y	0.723	0.62
15_N	18_H	0.708	0.60
43_W	58_R	0.703	0.60
36_P	42_Q	0.703	0.60
117_L	120_E	0.701	0.59
101_G	142_W	0.701	0.59
38_R	54_A	0.699	0.59
101_G	105_T	0.698	0.59
53_P	102_I	0.691	0.58
29_L	108_L	0.689	0.58
75_Y	129_E	0.686	0.58
130_L	135_F	0.686	0.58
18_H	26_W	0.685	0.58
114_L	117_L	0.684	0.57
30_F	46_L	0.684	0.57
26_W	40_S	0.677	0.57
43_W	49_Q	0.676	0.57
28_A	77_D	0.675	0.56
11_F	40_S	0.671	0.56
25_L	31_P	0.669	0.56
57_F	152_F	0.662	0.55
46_L	142_W	0.662	0.55
62_F	66_E	0.658	0.55
57_F	60_M	0.656	0.54
4_E	8_K	0.656	0.54
98_A	101_G	0.655	0.54
104_I	134_A	0.654	0.54
141_L	145_M	0.653	0.54
28_A	72_A	0.650	0.54
23_K	42_Q	0.646	0.53
113_R	117_L	0.645	0.53
103_N	112_L	0.645	0.53
18_H	43_W	0.642	0.53
44_K	99_V	0.641	0.53
11_F	54_A	0.641	0.53
52_D	55_T	0.634	0.52
65_L	102_I	0.632	0.52
71_F	134_A	0.632	0.52
141_L	144_E	0.631	0.52
108_L	114_L	0.631	0.52
3_L	64_G	0.624	0.51
100_A	104_I	0.623	0.51
28_A	69_L	0.621	0.50
58_R	99_V	0.615	0.50
48_F	93_W	0.613	0.50
3_L	108_L	0.612	0.49
106_F	110_E	0.611	0.49
27_K	34_E	0.607	0.49
82_L	148_T	0.607	0.49
114_L	135_F	0.605	0.49
75_Y	98_A	0.604	0.48
35_L	57_F	0.600	0.48
13_S	52_D	0.596	0.48
60_M	138_F	0.593	0.47
19_E	23_K	0.590	0.47
49_Q	150_M	0.588	0.47
71_F	82_L	0.587	0.47
148_T	153_N	0.587	0.47
17_E	90_P	0.586	0.46
39_I	52_D	0.585	0.46
68_L	91_A	0.585	0.46
124_L	128_D	0.584	0.46
43_W	47_G	0.575	0.45
7_R	63_L	0.571	0.45
44_K	96_P	0.568	0.44
49_Q	153_N	0.567	0.44
85_E	151_D	0.563	0.44
145_M	155_V	0.559	0.43
133_A	145_M	0.557	0.43
43_W	53_P	0.556	0.43
82_L	95_Y	0.556	0.43
73_R	104_I	0.554	0.43
23_K	35_L	0.552	0.43
55_T	103_N	0.551	0.43
85_E	94_E	0.550	0.42
82_L	139_D	0.546	0.42
9_V	17_E	0.545	0.42
3_L	46_L	0.545	0.42
64_G	87_S	0.545	0.42
79_F	108_L	0.544	0.42
59_G	110_E	0.541	0.41
35_L	38_R	0.540	0.41
70_Y	131_Y	0.540	0.41
39_I	42_Q	0.540	0.41
12_D	130_L	0.539	0.41
95_Y	99_V	0.537	0.41
43_W	50_G	0.534	0.41
118_K	122_N	0.534	0.41
40_S	49_Q	0.533	0.41
52_D	58_R	0.532	0.40
16_P	20_R	0.532	0.40
66_E	80_Q	0.528	0.40
133_A	137_L	0.527	0.40
104_I	108_L	0.526	0.40
112_L	138_F	0.522	0.39
39_I	153_N	0.520	0.39
78_S	82_L	0.519	0.39
79_F	97_F	0.517	0.39
77_D	81_K	0.517	0.39
20_R	72_A	0.517	0.39
64_G	131_Y	0.514	0.38
97_F	112_L	0.510	0.38
97_F	114_L	0.506	0.38
84_L	87_S	0.504	0.37
147_A	155_V	0.503	0.37
44_K	149_Y	0.502	0.37
58_R	149_Y	0.500	0.37

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2y9yB	1	0.8846	15.7	0.931	Contact Map
3opbA	2	0.9551	4.7	0.945	Contact Map
2lhuA	1	0.2179	4.7	0.945	Contact Map
1uz3A	2	0.3269	3	0.951	Contact Map
1q15A	3	0.5449	2.9	0.951	Contact Map
1xkpA	1	0.8269	2.5	0.953	Contact Map
3qk9A	2	0.3141	2	0.955	Contact Map
3pevB	1	0.9038	1.8	0.956	Contact Map
2idbA	3	0.3141	1.5	0.958	Contact Map
2vj4A	1	0.8141	1.5	0.958	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.