ATP-synt_G - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ATP-synt_G - Mitochondrial ATP synthase g subunit

PFAM:	PF04718	Sequences: NKVPSLVKPAVYYSKVRLELFKQYAKVEKLAPPTPAEFPSAYQQLFKLRLASPTSPKNLLGRWKNLTVKEAALNGLVGAEVLGWFFVGEIIGRRSLVGYK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	100 (92)
Sequences:	646 (420)
Seq/√Len:	43.8
META:	0.211

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
90_I	93_R	3.440	1.00
78_G	81_V	3.040	1.00
72_A	76_L	2.821	1.00
82_L	86_F	2.791	1.00
61_G	64_K	2.420	1.00
38_F	41_A	2.405	1.00
90_I	96_L	2.354	1.00
15_K	18_L	2.301	1.00
18_L	25_A	2.285	1.00
95_S	100_K	2.185	1.00
12_Y	16_V	1.990	0.99
79_A	83_G	1.980	0.99
19_E	22_K	1.890	0.99
75_G	78_G	1.877	0.99
11_V	15_K	1.834	0.99
78_G	82_L	1.708	0.98
68_V	71_A	1.708	0.98
87_V	96_L	1.693	0.98
66_L	96_L	1.690	0.97
89_E	98_G	1.656	0.97
15_K	19_E	1.491	0.95
86_F	90_I	1.466	0.94
23_Q	26_K	1.436	0.94
62_R	65_N	1.404	0.93
67_T	71_A	1.375	0.92
67_T	70_E	1.299	0.90
47_K	51_A	1.292	0.89
54_T	61_G	1.234	0.87
14_S	18_L	1.233	0.87
92_G	99_Y	1.226	0.87
36_A	39_P	1.210	0.86
37_E	40_S	1.178	0.84
31_A	85_F	1.164	0.84
43_Q	46_F	1.143	0.83
21_F	25_A	1.109	0.81
12_Y	15_K	1.095	0.80
70_E	73_L	1.074	0.79
75_G	83_G	1.073	0.78
5_S	9_P	1.073	0.78
4_P	28_E	1.039	0.76
49_R	52_S	1.020	0.75
49_R	53_P	1.019	0.75
44_Q	48_L	1.011	0.74
34_T	44_Q	1.007	0.74
4_P	8_K	1.003	0.74
13_Y	83_G	0.982	0.72
81_V	84_W	0.981	0.72
30_L	91_I	0.973	0.71
30_L	81_V	0.948	0.69
18_L	22_K	0.942	0.69
50_L	53_P	0.912	0.66
77_V	80_E	0.906	0.66
37_E	78_G	0.906	0.66
48_L	53_P	0.894	0.65
65_N	68_V	0.883	0.64
16_V	24_Y	0.860	0.62
7_V	10_A	0.858	0.61
42_Y	46_F	0.849	0.61
31_A	37_E	0.847	0.60
15_K	21_F	0.833	0.59
16_V	22_K	0.831	0.59
31_A	39_P	0.831	0.59
24_Y	38_F	0.817	0.58
21_F	24_Y	0.810	0.57
18_L	24_Y	0.800	0.56
80_E	84_W	0.797	0.56
4_P	7_V	0.789	0.55
10_A	64_K	0.781	0.54
93_R	98_G	0.780	0.54
83_G	93_R	0.779	0.54
41_A	45_L	0.774	0.54
6_L	10_A	0.763	0.53
94_R	100_K	0.760	0.52
8_K	13_Y	0.747	0.51
46_F	50_L	0.745	0.51
14_S	22_K	0.744	0.51
77_V	81_V	0.743	0.51
25_A	30_L	0.739	0.50
9_P	13_Y	0.739	0.50
51_A	61_G	0.739	0.50
66_L	80_E	0.720	0.48
26_K	76_L	0.720	0.48
83_G	90_I	0.715	0.48
40_S	44_Q	0.714	0.48
43_Q	85_F	0.708	0.47
10_A	13_Y	0.706	0.47
28_E	32_P	0.700	0.46
9_P	12_Y	0.697	0.46
12_Y	19_E	0.695	0.46
50_L	54_T	0.695	0.46
77_V	93_R	0.694	0.46
45_L	96_L	0.690	0.46
93_R	99_Y	0.689	0.45
52_S	60_L	0.680	0.45
31_A	96_L	0.679	0.44
16_V	20_L	0.678	0.44
88_G	99_Y	0.667	0.43
24_Y	90_I	0.649	0.42
43_Q	78_G	0.641	0.41
5_S	8_K	0.640	0.41
75_G	79_A	0.638	0.41
34_T	37_E	0.631	0.40
36_A	64_K	0.627	0.40
5_S	64_K	0.626	0.40
34_T	45_L	0.618	0.39
5_S	96_L	0.614	0.38
67_T	86_F	0.611	0.38
44_Q	47_K	0.603	0.37
83_G	86_F	0.599	0.37
84_W	87_V	0.597	0.37
72_A	90_I	0.592	0.36
71_A	74_N	0.584	0.36
38_F	93_R	0.583	0.36
42_Y	87_V	0.580	0.35
13_Y	79_A	0.579	0.35
64_K	91_I	0.572	0.35
90_I	94_R	0.571	0.35
35_P	70_E	0.570	0.35
72_A	100_K	0.569	0.34
33_P	85_F	0.561	0.34
71_A	76_L	0.554	0.33
13_Y	17_R	0.553	0.33
73_L	77_V	0.552	0.33
3_V	7_V	0.548	0.33
25_A	32_P	0.544	0.32
17_R	20_L	0.543	0.32
39_P	68_V	0.543	0.32
49_R	97_V	0.528	0.31
65_N	79_A	0.526	0.31
88_G	98_G	0.521	0.30
81_V	90_I	0.518	0.30
38_F	49_R	0.515	0.30
91_I	99_Y	0.511	0.30
13_Y	28_E	0.508	0.29
7_V	87_V	0.504	0.29
9_P	79_A	0.504	0.29
86_F	91_I	0.502	0.29
17_R	72_A	0.500	0.29

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2c1wA	1	0.79	10.7	0.917	Contact Map
3v76A	2	0.98	7	0.924	Contact Map
2w9yA	1	0.65	5.4	0.928	Contact Map
1xcrA	1	0.72	5.1	0.929	Contact Map
1seiA	2	0.63	5	0.929	Contact Map
3bbnH	1	0.65	3.9	0.933	Contact Map
4rb5H	1	0.65	2.9	0.937	Contact Map
3rf2A	1	0.65	2.8	0.937	Contact Map
4bzjA	2	0	2.8	0.937	Contact Map
4pdbA	1	0.64	2.6	0.938	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.