MCU - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MCU - Mitochondrial calcium uniporter

PFAM:	PF04678	Sequences: IQNEDQGIDFAAILDEDGVVIVLGTEVLLMHAKVFLDPKQVVKALETALPLEEHQLKKERELLPELERLREELEPLEKKKAEIDRKAEKRVRRELWAGLGLLSVQTGALARLTFWEYSWDVMEPITYFVTSGTFMAGYAYFLRTSQEPSYEDFFDRRFLSKQHKLAKKHNFDVERYNEL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	179 (172)
Sequences:	569 (365)
Seq/√Len:	27.8
META:	0.176

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
111_R	116_E	5.114	1.00
134_F	138_Y	5.056	1.00
80_K	84_D	4.860	1.00
72_E	175_R	4.235	1.00
109_L	129_V	3.540	1.00
175_R	178_E	3.157	1.00
161_K	165_L	2.894	1.00
34_V	38_P	2.794	1.00
74_E	78_K	2.621	0.99
90_R	93_R	2.576	0.99
122_M	125_I	2.512	0.99
111_R	115_W	2.486	0.99
149_S	152_D	2.457	0.99
112_L	116_E	2.438	0.99
128_F	133_T	1.909	0.95
73_L	77_E	1.800	0.93
6_Q	21_I	1.779	0.93
11_A	24_G	1.761	0.93
14_L	25_T	1.726	0.92
120_D	123_E	1.711	0.91
6_Q	9_D	1.691	0.91
21_I	129_V	1.676	0.91
4_E	25_T	1.629	0.89
107_G	126_T	1.536	0.86
89_K	168_K	1.517	0.86
110_A	114_F	1.509	0.85
4_E	8_I	1.496	0.85
8_I	135_M	1.458	0.83
76_L	179_L	1.457	0.83
106_T	109_L	1.442	0.82
108_A	129_V	1.440	0.82
10_F	13_I	1.436	0.82
114_F	131_S	1.433	0.82
148_P	162_Q	1.428	0.82
5_D	8_I	1.406	0.81
16_E	25_T	1.406	0.81
132_G	136_A	1.394	0.80
109_L	128_F	1.387	0.80
171_F	179_L	1.381	0.80
172_D	175_R	1.371	0.79
112_L	115_W	1.365	0.79
42_V	48_A	1.362	0.79
42_V	49_L	1.343	0.78
71_E	74_E	1.342	0.78
109_L	153_F	1.293	0.75
5_D	13_I	1.292	0.75
109_L	113_T	1.274	0.74
11_A	108_A	1.267	0.73
107_G	156_R	1.261	0.73
126_T	148_P	1.253	0.72
11_A	15_D	1.247	0.72
72_E	172_D	1.245	0.72
133_T	156_R	1.240	0.72
84_D	165_L	1.221	0.70
21_I	150_Y	1.213	0.70
9_D	17_D	1.209	0.70
36_L	40_Q	1.202	0.69
94_E	140_Y	1.183	0.68
93_R	96_W	1.179	0.68
79_K	130_T	1.179	0.68
79_K	169_H	1.177	0.68
95_L	104_V	1.161	0.67
102_L	106_T	1.158	0.66
64_P	67_E	1.136	0.65
44_A	121_V	1.122	0.64
58_K	61_E	1.119	0.64
3_N	6_Q	1.110	0.63
115_W	141_F	1.106	0.63
122_M	126_T	1.099	0.62
79_K	170_N	1.097	0.62
6_Q	17_D	1.095	0.62
129_V	137_G	1.086	0.61
99_L	141_F	1.085	0.61
35_F	41_V	1.076	0.60
173_V	177_N	1.069	0.60
6_Q	12_A	1.067	0.60
82_E	85_R	1.062	0.59
61_E	104_V	1.059	0.59
77_E	135_M	1.057	0.59
115_W	118_S	1.047	0.58
45_L	75_P	1.040	0.58
77_E	81_A	1.008	0.55
110_A	127_Y	0.999	0.55
10_F	17_D	0.999	0.55
76_L	130_T	0.997	0.55
7_G	22_V	0.993	0.54
4_E	9_D	0.989	0.54
18_G	25_T	0.987	0.54
176_Y	179_L	0.980	0.53
167_K	170_N	0.970	0.53
83_I	169_H	0.965	0.52
110_A	117_Y	0.964	0.52
114_F	126_T	0.960	0.52
133_T	141_F	0.956	0.51
135_M	154_F	0.941	0.50
12_A	74_E	0.939	0.50
140_Y	143_R	0.936	0.50
42_V	50_P	0.926	0.49
11_A	14_L	0.924	0.49
73_L	98_G	0.923	0.49
82_E	86_K	0.921	0.49
9_D	20_V	0.913	0.48
52_E	82_E	0.908	0.48
17_D	24_G	0.904	0.47
6_Q	14_L	0.897	0.47
107_G	128_F	0.891	0.47
113_T	138_Y	0.879	0.46
109_L	142_L	0.873	0.45
113_T	142_L	0.872	0.45
69_L	126_T	0.867	0.45
10_F	21_I	0.864	0.44
158_F	162_Q	0.864	0.44
12_A	16_E	0.858	0.44
174_E	178_E	0.858	0.44
39_K	49_L	0.855	0.44
41_V	81_A	0.848	0.43
20_V	38_P	0.844	0.43
150_Y	171_F	0.836	0.42
42_V	101_L	0.835	0.42
55_Q	58_K	0.831	0.42
90_R	161_K	0.829	0.42
19_V	168_K	0.814	0.41
7_G	23_L	0.812	0.41
146_Q	163_H	0.811	0.40
11_A	22_V	0.810	0.40
113_T	130_T	0.809	0.40
128_F	156_R	0.809	0.40
114_F	122_M	0.806	0.40
11_A	142_L	0.806	0.40
106_T	127_Y	0.789	0.39
4_E	45_L	0.789	0.39
97_A	164_K	0.786	0.39
115_W	130_T	0.785	0.39
84_D	162_Q	0.783	0.38
98_G	141_F	0.772	0.38
117_Y	127_Y	0.759	0.37
72_E	87_A	0.756	0.37
58_K	62_L	0.747	0.36
61_E	64_P	0.746	0.36
33_K	108_A	0.742	0.36
126_T	140_Y	0.736	0.35
14_L	48_A	0.734	0.35
138_Y	141_F	0.733	0.35
5_D	159_L	0.731	0.35
96_W	139_A	0.731	0.35
17_D	23_L	0.731	0.35
94_E	157_R	0.726	0.34
118_S	124_P	0.718	0.34
69_L	114_F	0.718	0.34
3_N	13_I	0.717	0.34
96_W	144_T	0.716	0.34
83_I	90_R	0.715	0.34
103_S	159_L	0.709	0.33
17_D	100_G	0.708	0.33
18_G	21_I	0.707	0.33
16_E	65_E	0.699	0.33
61_E	142_L	0.698	0.33
56_L	84_D	0.696	0.32
15_D	22_V	0.695	0.32
21_I	97_A	0.694	0.32
74_E	178_E	0.694	0.32
15_D	23_L	0.693	0.32
13_I	173_V	0.686	0.32
140_Y	161_K	0.682	0.31
44_A	164_K	0.673	0.31
7_G	21_I	0.666	0.30
14_L	20_V	0.665	0.30
85_R	173_V	0.661	0.30
80_K	93_R	0.661	0.30
3_N	20_V	0.660	0.30
71_E	97_A	0.659	0.30
25_T	160_S	0.650	0.29
9_D	12_A	0.650	0.29
43_K	48_A	0.646	0.29
13_I	19_V	0.646	0.29
45_L	96_W	0.645	0.29
36_L	41_V	0.642	0.29
18_G	72_E	0.636	0.28
13_I	88_E	0.633	0.28
101_L	104_V	0.629	0.28
14_L	34_V	0.627	0.28
119_W	123_E	0.625	0.28
51_L	62_L	0.625	0.28
93_R	161_K	0.621	0.28
19_V	25_T	0.617	0.27
42_V	45_L	0.616	0.27
3_N	10_F	0.615	0.27
86_K	104_V	0.615	0.27
7_G	12_A	0.613	0.27
125_I	133_T	0.610	0.27
64_P	164_K	0.608	0.27
63_L	75_P	0.606	0.27
162_Q	166_A	0.599	0.26
94_E	97_A	0.598	0.26
17_D	20_V	0.594	0.26
15_D	85_R	0.593	0.26
8_I	14_L	0.592	0.26
17_D	151_E	0.587	0.26
7_G	10_F	0.586	0.25
25_T	39_K	0.586	0.25
125_I	128_F	0.586	0.25
75_P	173_V	0.585	0.25
84_D	87_A	0.584	0.25
84_D	166_A	0.584	0.25
10_F	23_L	0.584	0.25
43_K	67_E	0.584	0.25
41_V	52_E	0.583	0.25
97_A	137_G	0.582	0.25
121_V	150_Y	0.581	0.25
55_Q	59_E	0.579	0.25
82_E	169_H	0.578	0.25
49_L	66_L	0.575	0.25
117_Y	128_F	0.573	0.25
14_L	23_L	0.571	0.25
113_T	116_E	0.571	0.25
74_E	176_Y	0.569	0.25
147_E	159_L	0.569	0.25
135_M	156_R	0.568	0.24
110_A	113_T	0.568	0.24
96_W	128_F	0.566	0.24
35_F	38_P	0.562	0.24
113_T	128_F	0.562	0.24
44_A	147_E	0.562	0.24
6_Q	19_V	0.559	0.24
110_A	148_P	0.555	0.24
116_E	176_Y	0.554	0.24
110_A	130_T	0.551	0.23
105_Q	125_I	0.550	0.23
41_V	45_L	0.549	0.23
7_G	136_A	0.546	0.23
11_A	20_V	0.542	0.23
110_A	126_T	0.540	0.23
4_E	7_G	0.535	0.23
107_G	146_Q	0.535	0.23
105_Q	109_L	0.534	0.23
79_K	82_E	0.532	0.22
3_N	86_K	0.532	0.22
94_E	175_R	0.531	0.22
105_Q	133_T	0.531	0.22
149_S	170_N	0.529	0.22
109_L	148_P	0.529	0.22
118_S	121_V	0.529	0.22
107_G	132_G	0.528	0.22
15_D	20_V	0.526	0.22
126_T	143_R	0.524	0.22
4_E	103_S	0.524	0.22
107_G	139_A	0.524	0.22
20_V	24_G	0.522	0.22
147_E	155_D	0.521	0.22
90_R	94_E	0.517	0.22
73_L	79_K	0.516	0.22
32_A	160_S	0.514	0.22
114_F	165_L	0.510	0.21
33_K	81_A	0.506	0.21
50_P	133_T	0.506	0.21
98_G	120_D	0.504	0.21
147_E	173_V	0.503	0.21
116_E	141_F	0.500	0.21

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2m8rA	1	0.5978	40	0.928	Contact Map
3dptA	2	0.5363	26.5	0.935	Contact Map
4flaA	2	0.4749	25.4	0.935	Contact Map
4wnrA	1	0.5978	18.5	0.939	Contact Map
2yy0A	6	0.2961	14.1	0.942	Contact Map
3rrkA	1	0.9162	13.2	0.943	Contact Map
4qinA	2	0.838	12.2	0.944	Contact Map
3ljcA	1	0.4693	11.5	0.945	Contact Map
1gaxA	1	0.4637	10.6	0.946	Contact Map
4rsjA	2	0.4972	8	0.949	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.