ERG2_Sigma1R - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ERG2_Sigma1R - ERG2 and Sigma1 receptor like protein

PFAM:	PF04622	Sequences: VLLALLAALYYLLDTWLPKFYVFDPEVLHEIAKRAIGAHPLPTEEMVDAIVDELAERYPGHYINLDTDEEWVFNNAGGAMGAMYILHASITEYLIIFGTPIGTEGHSGRHTADDYFTILDGEQWAYTEGQLEREVYRPGDVHHLPRGQAKQYKMPEGCWALEYARGWIPSMLPFGLADTLFSTLDFPTLWRTVRIYGREMIRNLLRGK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	208 (199)
Sequences:	624 (397)
Seq/√Len:	28.2
META:	0.481

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
167_W	170_S	3.048	1.00
179_T	189_L	2.927	1.00
130_Q	134_E	2.826	1.00
124_W	133_R	2.787	1.00
176_L	193_V	2.754	1.00
180_L	189_L	2.717	1.00
117_T	141_V	2.647	0.99
75_N	106_H	2.597	0.99
125_A	142_H	2.476	0.99
137_R	140_D	2.340	0.99
47_V	96_I	2.327	0.99
61_H	203_N	2.321	0.99
82_A	159_W	2.294	0.99
178_D	182_S	2.249	0.98
75_N	183_T	2.223	0.98
79_A	152_Y	2.185	0.98
113_D	143_H	2.170	0.98
123_Q	142_H	2.168	0.98
80_M	106_H	2.069	0.97
34_R	53_E	2.059	0.97
77_G	174_F	2.040	0.97
144_L	150_K	1.925	0.96
85_I	196_Y	1.918	0.95
80_M	174_F	1.905	0.95
116_F	160_A	1.899	0.95
29_H	141_V	1.868	0.95
75_N	80_M	1.857	0.95
61_H	87_H	1.781	0.93
10_Y	14_D	1.741	0.92
142_H	150_K	1.736	0.92
189_L	193_V	1.704	0.92
88_A	196_Y	1.680	0.91
118_I	123_Q	1.672	0.91
197_G	204_L	1.652	0.90
17_L	20_F	1.640	0.90
116_F	123_Q	1.627	0.90
82_A	126_Y	1.612	0.89
51_V	96_I	1.611	0.89
112_A	167_W	1.574	0.88
35_A	50_I	1.564	0.88
76_A	97_F	1.541	0.87
51_V	86_L	1.536	0.87
27_V	57_R	1.536	0.87
50_I	53_E	1.524	0.86
134_E	150_K	1.518	0.86
118_I	160_A	1.513	0.86
114_D	152_Y	1.496	0.85
27_V	58_Y	1.494	0.85
98_G	159_W	1.490	0.85
114_D	164_A	1.452	0.83
113_D	146_R	1.449	0.83
114_D	160_A	1.439	0.83
81_G	97_F	1.413	0.82
124_W	153_K	1.398	0.81
50_I	119_L	1.397	0.81
74_N	152_Y	1.341	0.78
122_E	137_R	1.332	0.77
76_A	174_F	1.319	0.77
111_T	170_S	1.312	0.76
201_I	205_L	1.297	0.76
35_A	49_A	1.282	0.75
109_R	149_A	1.278	0.74
10_Y	13_L	1.277	0.74
11_Y	15_T	1.267	0.74
123_Q	160_A	1.262	0.73
24_D	27_V	1.261	0.73
70_E	198_R	1.258	0.73
10_Y	16_W	1.245	0.72
30_E	34_R	1.239	0.72
72_V	195_I	1.237	0.72
154_M	157_G	1.229	0.71
78_G	178_D	1.223	0.71
94_L	110_H	1.215	0.71
114_D	123_Q	1.213	0.70
155_P	158_C	1.205	0.70
197_G	201_I	1.196	0.69
107_S	142_H	1.188	0.69
27_V	31_I	1.175	0.68
72_V	85_I	1.174	0.68
145_P	148_Q	1.172	0.68
196_Y	200_M	1.167	0.67
12_L	16_W	1.163	0.67
114_D	142_H	1.153	0.66
124_W	156_E	1.150	0.66
10_Y	15_T	1.147	0.66
21_Y	115_Y	1.145	0.66
29_H	117_T	1.140	0.66
199_E	203_N	1.131	0.65
114_D	125_A	1.124	0.64
80_M	183_T	1.121	0.64
12_L	15_T	1.118	0.64
114_D	171_M	1.113	0.64
54_L	191_R	1.112	0.64
120_D	157_G	1.084	0.62
88_A	169_P	1.067	0.60
8_A	12_L	1.062	0.60
8_A	11_Y	1.056	0.60
81_G	152_Y	1.050	0.59
35_A	53_E	1.038	0.58
87_H	182_S	1.031	0.58
101_I	155_P	1.025	0.57
83_M	95_I	1.018	0.57
47_V	131_L	1.015	0.56
51_V	84_Y	1.009	0.56
134_E	142_H	1.006	0.56
116_F	142_H	1.006	0.56
32_A	36_I	1.001	0.55
164_A	175_G	0.990	0.55
31_I	53_E	0.983	0.54
114_D	118_I	0.975	0.53
32_A	94_L	0.973	0.53
8_A	15_T	0.967	0.53
115_Y	141_V	0.963	0.52
74_N	103_T	0.962	0.52
22_V	50_I	0.961	0.52
164_A	171_M	0.960	0.52
31_I	50_I	0.956	0.52
23_F	73_F	0.942	0.51
118_I	158_C	0.941	0.51
60_G	128_E	0.939	0.51
99_T	104_E	0.930	0.50
125_A	171_M	0.923	0.49
52_D	94_L	0.923	0.49
142_H	160_A	0.918	0.49
190_W	194_R	0.905	0.48
174_F	183_T	0.902	0.48
110_H	160_A	0.900	0.48
126_Y	151_Q	0.899	0.48
46_M	119_L	0.899	0.48
9_L	16_W	0.897	0.47
9_L	14_D	0.894	0.47
104_E	126_Y	0.887	0.47
50_I	94_L	0.883	0.46
74_N	175_G	0.876	0.46
8_A	40_P	0.876	0.46
105_G	108_G	0.874	0.46
34_R	49_A	0.873	0.46
171_M	183_T	0.857	0.44
93_Y	98_G	0.848	0.44
154_M	160_A	0.837	0.43
194_R	199_E	0.832	0.42
36_I	138_P	0.831	0.42
70_E	84_Y	0.828	0.42
79_A	95_I	0.827	0.42
79_A	171_M	0.822	0.42
110_H	164_A	0.817	0.41
124_W	155_P	0.817	0.41
85_I	195_I	0.814	0.41
191_R	194_R	0.807	0.41
112_A	168_I	0.805	0.40
180_L	187_P	0.803	0.40
82_A	100_P	0.803	0.40
50_I	54_L	0.792	0.39
9_L	13_L	0.790	0.39
79_A	103_T	0.790	0.39
136_Y	183_T	0.785	0.39
154_M	158_C	0.783	0.39
110_H	114_D	0.783	0.39
82_A	128_E	0.779	0.39
107_S	144_L	0.776	0.38
60_G	206_R	0.765	0.38
16_W	20_F	0.764	0.37
172_L	189_L	0.762	0.37
29_H	33_K	0.761	0.37
13_L	16_W	0.761	0.37
101_I	151_Q	0.761	0.37
85_I	88_A	0.760	0.37
74_N	97_F	0.754	0.37
97_F	103_T	0.751	0.37
176_L	189_L	0.749	0.36
75_N	188_T	0.736	0.35
81_G	168_I	0.735	0.35
74_N	178_D	0.734	0.35
186_F	205_L	0.731	0.35
125_A	134_E	0.729	0.35
202_R	206_R	0.727	0.35
65_L	163_Y	0.722	0.34
59_P	63_I	0.713	0.34
28_L	161_L	0.712	0.34
106_H	125_A	0.709	0.34
33_K	44_E	0.708	0.34
77_G	183_T	0.707	0.33
48_D	52_D	0.701	0.33
192_T	196_Y	0.701	0.33
55_A	60_G	0.698	0.33
52_D	56_E	0.697	0.33
83_M	192_T	0.692	0.32
86_L	170_S	0.690	0.32
195_I	198_R	0.689	0.32
76_A	178_D	0.688	0.32
37_G	200_M	0.685	0.32
127_T	148_Q	0.685	0.32
196_Y	199_E	0.681	0.32
200_M	205_L	0.677	0.31
116_F	125_A	0.672	0.31
182_S	192_T	0.669	0.31
40_P	44_E	0.659	0.30
15_T	18_P	0.657	0.30
58_Y	63_I	0.656	0.30
16_W	100_P	0.653	0.30
82_A	129_G	0.652	0.30
112_A	164_A	0.652	0.30
30_E	57_R	0.651	0.30
74_N	192_T	0.651	0.30
90_I	110_H	0.642	0.29
14_D	58_Y	0.641	0.29
186_F	190_W	0.639	0.29
125_A	152_Y	0.637	0.29
85_I	138_P	0.636	0.29
48_D	94_L	0.635	0.29
90_I	169_P	0.635	0.29
123_Q	152_Y	0.634	0.29
150_K	160_A	0.632	0.29
9_L	18_P	0.631	0.28
55_A	205_L	0.630	0.28
168_I	171_M	0.629	0.28
107_S	181_F	0.628	0.28
27_V	32_A	0.628	0.28
75_N	171_M	0.626	0.28
176_L	192_T	0.621	0.28
90_I	95_I	0.621	0.28
93_Y	162_E	0.619	0.28
152_Y	171_M	0.616	0.28
39_H	42_P	0.616	0.28
8_A	13_L	0.612	0.27
9_L	12_L	0.610	0.27
73_F	172_L	0.610	0.27
177_A	183_T	0.609	0.27
95_I	114_D	0.608	0.27
136_Y	140_D	0.605	0.27
59_P	96_I	0.600	0.27
194_R	198_R	0.599	0.26
44_E	69_E	0.596	0.26
74_N	102_G	0.595	0.26
104_E	124_W	0.594	0.26
174_F	177_A	0.589	0.26
113_D	145_P	0.588	0.26
13_L	42_P	0.587	0.26
56_E	59_P	0.587	0.26
31_I	34_R	0.586	0.26
12_L	17_L	0.584	0.26
96_I	191_R	0.583	0.26
118_I	142_H	0.583	0.26
24_D	173_P	0.582	0.25
95_I	152_Y	0.581	0.25
125_A	160_A	0.580	0.25
87_H	176_L	0.577	0.25
49_A	53_E	0.577	0.25
171_M	174_F	0.577	0.25
11_Y	16_W	0.576	0.25
31_I	49_A	0.573	0.25
16_W	40_P	0.573	0.25
150_K	203_N	0.569	0.25
116_F	164_A	0.568	0.25
75_N	87_H	0.568	0.25
180_L	194_R	0.567	0.25
187_P	194_R	0.564	0.24
188_T	192_T	0.563	0.24
37_G	43_T	0.558	0.24
25_P	180_L	0.557	0.24
17_L	133_R	0.552	0.24
106_H	129_G	0.549	0.24
55_A	67_T	0.547	0.23
112_A	174_F	0.546	0.23
80_M	112_A	0.545	0.23
72_V	191_R	0.544	0.23
144_L	152_Y	0.543	0.23
59_P	202_R	0.543	0.23
80_M	152_Y	0.539	0.23
76_A	177_A	0.538	0.23
53_E	57_R	0.538	0.23
174_F	178_D	0.536	0.23
79_A	104_E	0.536	0.23
41_L	44_E	0.536	0.23
123_Q	150_K	0.532	0.23
88_A	167_W	0.531	0.23
171_M	175_G	0.531	0.23
118_I	144_L	0.530	0.23
136_Y	175_G	0.526	0.22
87_H	91_T	0.525	0.22
18_P	100_P	0.525	0.22
9_L	15_T	0.522	0.22
143_H	146_R	0.522	0.22
15_T	130_Q	0.522	0.22
75_N	178_D	0.521	0.22
118_I	154_M	0.520	0.22
186_F	194_R	0.518	0.22
14_D	146_R	0.518	0.22
197_G	205_L	0.515	0.22
10_Y	19_K	0.515	0.22
178_D	188_T	0.514	0.22
15_T	60_G	0.514	0.22
97_F	152_Y	0.512	0.22
109_R	187_P	0.510	0.22
86_L	199_E	0.508	0.21
46_M	120_D	0.506	0.21
83_M	87_H	0.500	0.21
89_S	99_T	0.500	0.21

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3balA	4	0.6779	95.5	0.92	Contact Map
2o1qA	4	0.6538	94.1	0.926	Contact Map
5bpxA	2	0.6827	88.7	0.936	Contact Map
4p9gA	2	0.649	83.3	0.941	Contact Map
3cjxA	6	0.7019	77.7	0.944	Contact Map
1yhfA	2	0.5481	76.2	0.945	Contact Map
3ebrA	4	0.6971	66.3	0.949	Contact Map
2cavA	3	0.726	66.1	0.949	Contact Map
2q1zB	1	0.6779	64.7	0.949	Contact Map
3s7iA	3	0.726	64	0.949	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.