DUF568 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF568 - Protein of unknown function (DUF568)

PFAM:	PF04526	Sequences: MVGSQALVAFPQNSSGSMVVYTYNITSYSSLQEGPLSFDVSDLSAEYSGGEMTIFATLKLPLGNSTTVNQVWQVGPSVSGGVPAKHPTSGDNLQSKGTLDL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	101 (99)
Sequences:	518 (377)
Seq/√Len:	37.9
META:	0.085

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
31_L	34_G	4.266	1.00
88_T	93_L	3.078	1.00
66_T	100_D	2.913	1.00
90_G	93_L	2.864	1.00
30_S	34_G	2.748	1.00
91_D	94_Q	2.433	1.00
10_F	78_V	2.414	1.00
85_K	88_T	2.373	1.00
40_V	56_A	2.367	1.00
79_S	84_A	2.351	1.00
5_Q	28_Y	2.069	0.99
70_Q	97_G	1.958	0.98
17_S	83_P	1.825	0.98
60_L	80_G	1.788	0.97
90_G	94_Q	1.760	0.97
24_N	34_G	1.664	0.96
6_A	25_I	1.636	0.95
93_L	96_K	1.628	0.95
74_V	92_N	1.611	0.95
77_S	84_A	1.610	0.95
21_Y	33_E	1.580	0.94
35_P	39_D	1.495	0.92
68_V	101_L	1.484	0.92
41_S	59_K	1.396	0.90
36_L	40_V	1.391	0.89
18_M	45_A	1.364	0.88
89_S	94_Q	1.304	0.86
5_Q	37_S	1.248	0.83
49_G	79_S	1.220	0.82
6_A	58_L	1.195	0.81
69_N	89_S	1.192	0.80
94_Q	97_G	1.188	0.80
18_M	52_M	1.178	0.80
78_V	93_L	1.167	0.79
12_Q	47_Y	1.162	0.79
68_V	76_P	1.157	0.78
8_V	83_P	1.137	0.77
22_T	69_N	1.066	0.72
5_Q	70_Q	1.051	0.71
50_G	73_Q	1.025	0.69
2_V	85_K	1.022	0.69
10_F	97_G	1.015	0.69
37_S	43_L	1.000	0.68
44_S	53_T	0.997	0.67
5_Q	25_I	0.995	0.67
15_S	29_S	0.980	0.66
6_A	53_T	0.945	0.63
40_V	44_S	0.927	0.62
72_W	75_G	0.925	0.61
73_Q	92_N	0.922	0.61
41_S	58_L	0.917	0.61
38_F	73_Q	0.914	0.60
57_T	61_P	0.911	0.60
15_S	35_P	0.908	0.60
12_Q	101_L	0.906	0.60
58_L	100_D	0.904	0.60
7_L	78_V	0.902	0.59
14_S	87_P	0.886	0.58
23_Y	101_L	0.885	0.58
47_Y	57_T	0.882	0.58
46_E	55_F	0.881	0.58
30_S	50_G	0.880	0.58
2_V	71_V	0.875	0.57
10_F	18_M	0.857	0.56
60_L	65_S	0.856	0.55
37_S	44_S	0.854	0.55
37_S	95_S	0.851	0.55
27_S	56_A	0.848	0.55
78_V	92_N	0.838	0.54
61_P	74_V	0.838	0.54
39_D	42_D	0.827	0.53
44_S	55_F	0.823	0.52
12_Q	18_M	0.798	0.50
7_L	101_L	0.796	0.50
71_V	95_S	0.790	0.50
56_A	61_P	0.787	0.49
74_V	87_P	0.786	0.49
68_V	99_L	0.781	0.49
89_S	96_K	0.779	0.49
43_L	56_A	0.779	0.49
4_S	8_V	0.778	0.48
21_Y	24_N	0.774	0.48
77_S	80_G	0.757	0.47
78_V	99_L	0.744	0.45
13_N	100_D	0.744	0.45
41_S	47_Y	0.739	0.45
14_S	81_G	0.736	0.45
22_T	92_N	0.727	0.44
9_A	45_A	0.720	0.43
41_S	60_L	0.711	0.43
47_Y	70_Q	0.709	0.42
76_P	87_P	0.703	0.42
21_Y	51_E	0.699	0.42
74_V	81_G	0.697	0.41
63_G	99_L	0.694	0.41
20_V	69_N	0.693	0.41
38_F	58_L	0.693	0.41
42_D	59_K	0.688	0.41
25_I	40_V	0.680	0.40
15_S	56_A	0.679	0.40
53_T	74_V	0.677	0.40
15_S	51_E	0.673	0.39
20_V	45_A	0.670	0.39
68_V	96_K	0.669	0.39
67_T	101_L	0.660	0.38
46_E	50_G	0.652	0.37
54_I	61_P	0.645	0.37
8_V	89_S	0.643	0.37
26_T	32_Q	0.635	0.36
25_I	29_S	0.633	0.36
87_P	96_K	0.632	0.36
57_T	60_L	0.627	0.35
39_D	59_K	0.616	0.35
28_Y	53_T	0.615	0.34
4_S	14_S	0.615	0.34
50_G	81_G	0.612	0.34
29_S	85_K	0.611	0.34
25_I	48_S	0.609	0.34
3_G	6_A	0.604	0.34
2_V	10_F	0.603	0.33
35_P	93_L	0.603	0.33
67_T	98_T	0.598	0.33
57_T	63_G	0.595	0.33
27_S	30_S	0.591	0.33
43_L	100_D	0.580	0.32
22_T	25_I	0.579	0.32
38_F	41_S	0.578	0.32
29_S	101_L	0.577	0.31
26_T	30_S	0.573	0.31
22_T	38_F	0.566	0.31
27_S	95_S	0.554	0.30
23_Y	33_E	0.548	0.29
64_N	100_D	0.547	0.29
93_L	98_T	0.546	0.29
63_G	70_Q	0.541	0.29
1_M	9_A	0.537	0.28
16_G	57_T	0.534	0.28
4_S	71_V	0.526	0.28
55_F	80_G	0.525	0.28
12_Q	15_S	0.523	0.27
33_E	52_M	0.523	0.27
18_M	97_G	0.520	0.27
26_T	83_P	0.511	0.27
26_T	31_L	0.510	0.27
18_M	64_N	0.508	0.26
9_A	18_M	0.507	0.26
4_S	30_S	0.505	0.26
56_A	90_G	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1d7bA	2	0.9109	17.1	0.922	Contact Map
2ygnA	2	0.7426	8	0.933	Contact Map
2ygoA	2	0.7327	4.8	0.939	Contact Map
2oxgY	1	0.3168	4	0.941	Contact Map
4uqdA	1	0.5941	3.2	0.944	Contact Map
1i2hA	1	0.8515	3	0.945	Contact Map
3wa1A	4	0.3267	3	0.945	Contact Map
4qi3A	2	0.901	2.6	0.947	Contact Map
2nt0A	4	0.5743	2.4	0.948	Contact Map
3bw8A	1	0.5842	2.2	0.949	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.