CD225 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CD225 - Interferon-induced transmembrane protein

PFAM:	PF04505	Sequences: NPPQPPPPPPKNYLVWAILVTLFCCLPLGIVAIVYAAQVNSKWAAGDYAGAQRASKKAKKWAIISFGLGLVVIVLY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	76 (70)
Sequences:	6420 (4788)
Seq/√Len:	572.3
META:	0.797

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
47_D	50_G	2.907	1.00
60_K	64_I	2.213	1.00
53_R	57_K	2.163	1.00
63_I	67_G	2.158	1.00
15_V	19_L	1.916	1.00
42_K	50_G	1.863	1.00
35_Y	57_K	1.648	1.00
35_Y	38_Q	1.609	1.00
52_Q	56_K	1.577	1.00
32_A	62_A	1.528	1.00
30_I	34_V	1.518	1.00
9_P	40_N	1.502	1.00
42_K	54_A	1.493	1.00
20_V	62_A	1.435	1.00
28_L	65_S	1.428	1.00
39_V	55_S	1.395	1.00
9_P	43_W	1.378	1.00
38_Q	42_K	1.377	1.00
42_K	47_D	1.346	1.00
12_N	40_N	1.332	1.00
48_Y	52_Q	1.320	1.00
17_A	32_A	1.316	1.00
59_K	63_I	1.294	1.00
21_T	33_I	1.286	1.00
16_W	62_A	1.283	1.00
43_W	48_Y	1.273	1.00
67_G	71_V	1.273	1.00
56_K	60_K	1.270	1.00
38_Q	54_A	1.235	1.00
40_N	44_A	1.201	1.00
49_A	52_Q	1.198	1.00
19_L	23_F	1.197	1.00
10_P	43_W	1.188	1.00
20_V	65_S	1.171	1.00
41_S	45_A	1.159	1.00
57_K	61_W	1.141	1.00
13_Y	16_W	1.132	1.00
28_L	61_W	1.113	1.00
64_I	68_L	1.095	1.00
13_Y	55_S	1.091	1.00
13_Y	62_A	1.082	1.00
69_G	73_I	1.081	1.00
16_W	66_F	1.012	1.00
49_A	53_R	0.995	1.00
62_A	66_F	0.992	1.00
11_K	16_W	0.983	1.00
31_V	35_Y	0.982	1.00
57_K	60_K	0.929	1.00
35_Y	54_A	0.929	1.00
7_P	52_Q	0.919	1.00
50_G	54_A	0.918	1.00
14_L	18_I	0.912	1.00
16_W	63_I	0.908	1.00
31_V	61_W	0.906	1.00
68_L	72_V	0.885	1.00
58_A	62_A	0.866	1.00
21_T	29_G	0.862	1.00
9_P	44_A	0.854	1.00
42_K	45_A	0.825	1.00
17_A	62_A	0.824	1.00
16_W	20_V	0.822	1.00
13_Y	59_K	0.820	1.00
39_V	58_A	0.814	1.00
7_P	48_Y	0.808	1.00
14_L	37_A	0.805	1.00
37_A	41_S	0.784	1.00
28_L	68_L	0.771	1.00
27_P	31_V	0.760	1.00
63_I	66_F	0.758	1.00
33_I	37_A	0.708	1.00
13_Y	17_A	0.696	1.00
14_L	33_I	0.684	1.00
53_R	56_K	0.667	1.00
20_V	66_F	0.658	1.00
39_V	43_W	0.653	1.00
39_V	54_A	0.652	1.00
28_L	31_V	0.651	1.00
34_V	38_Q	0.650	1.00
32_A	65_S	0.647	1.00
25_C	28_L	0.645	1.00
7_P	43_W	0.641	1.00
54_A	57_K	0.629	1.00
36_A	58_A	0.599	1.00
16_W	59_K	0.592	1.00
56_K	59_K	0.583	1.00
28_L	64_I	0.571	1.00
8_P	43_W	0.570	0.99
26_L	31_V	0.570	0.99
17_A	36_A	0.564	0.99
66_F	70_L	0.564	0.99
25_C	68_L	0.558	0.99
68_L	71_V	0.557	0.99
11_K	55_S	0.547	0.99
34_V	37_A	0.545	0.99
51_A	55_S	0.543	0.99
35_Y	61_W	0.542	0.99
70_L	73_I	0.538	0.99
16_W	19_L	0.538	0.99
17_A	20_V	0.533	0.99
13_Y	58_A	0.529	0.99
68_L	73_I	0.524	0.99
18_I	22_L	0.522	0.99
43_W	51_A	0.504	0.99
65_S	69_G	0.503	0.99
60_K	67_G	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1fftB	1	1	32.9	0.832	Contact Map
4yayA	1	0.8026	22.3	0.845	Contact Map
3ayfA	2	0.9605	17.7	0.852	Contact Map
4n6hA	1	0.9868	13.3	0.86	Contact Map
4ea3A	2	0.9868	12.9	0.861	Contact Map
3v2yA	1	0.9342	11.7	0.864	Contact Map
2j7aC	2	0.2237	11	0.865	Contact Map
4ldeA	1	0.9474	11	0.865	Contact Map
4grvA	1	1	10.7	0.866	Contact Map
4pxzA	1	1	10.4	0.867	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.