DUF573 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF573 - Protein of unknown function, DUF573

PFAM:	PF04504	Sequences: FQRLWSEEDEIAILQGLIDYRAKKGTSPYPDTDAFYDFIKGSLSFDVSKSQLVEKIRRLKKKYRNNVKKIKSGKDPSFSKPHDQKLFELSKKIWG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	95 (94)
Sequences:	542 (386)
Seq/√Len:	39.8
META:	0.1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_L	56_I	3.288	1.00
54_E	57_R	2.524	1.00
48_S	51_Q	2.509	1.00
74_K	77_S	2.374	1.00
12_A	18_I	2.370	1.00
4_L	50_S	2.351	1.00
13_I	52_L	2.200	0.99
24_K	76_P	2.053	0.99
10_E	82_H	2.046	0.99
35_F	43_L	1.935	0.99
29_Y	56_I	1.843	0.98
17_L	93_I	1.709	0.97
5_W	63_Y	1.661	0.96
4_L	62_K	1.586	0.95
18_I	93_I	1.532	0.94
69_K	74_K	1.504	0.94
38_F	44_S	1.450	0.92
6_S	49_K	1.445	0.92
54_E	58_R	1.442	0.92
13_I	43_L	1.441	0.92
4_L	37_D	1.430	0.92
24_K	42_S	1.408	0.91
20_Y	78_F	1.407	0.91
90_S	94_W	1.405	0.91
5_W	60_K	1.336	0.89
54_E	63_Y	1.311	0.88
50_S	53_V	1.297	0.87
3_R	10_E	1.289	0.87
5_W	18_I	1.252	0.85
73_G	76_P	1.229	0.84
5_W	39_I	1.220	0.84
88_E	92_K	1.193	0.82
32_T	60_K	1.193	0.82
36_Y	77_S	1.180	0.81
52_L	92_K	1.175	0.81
64_R	80_K	1.165	0.81
15_Q	43_L	1.164	0.81
59_L	88_E	1.161	0.80
5_W	10_E	1.156	0.80
3_R	39_I	1.134	0.79
33_D	41_G	1.113	0.78
30_P	35_F	1.109	0.77
16_G	39_I	1.092	0.76
22_A	50_S	1.092	0.76
7_E	11_I	1.088	0.76
13_I	26_T	1.055	0.74
86_L	93_I	1.033	0.72
55_K	95_G	1.032	0.72
50_S	62_K	1.026	0.71
6_S	47_V	0.999	0.69
19_D	90_S	0.991	0.69
7_E	62_K	0.988	0.69
82_H	86_L	0.984	0.68
3_R	84_Q	0.983	0.68
64_R	83_D	0.983	0.68
22_A	92_K	0.972	0.67
15_Q	93_I	0.968	0.67
19_D	74_K	0.965	0.67
17_L	87_F	0.964	0.67
17_L	32_T	0.961	0.66
84_Q	88_E	0.943	0.65
5_W	73_G	0.935	0.64
33_D	58_R	0.932	0.64
42_S	95_G	0.922	0.63
7_E	22_A	0.916	0.63
63_Y	90_S	0.915	0.63
50_S	57_R	0.910	0.62
36_Y	64_R	0.881	0.60
79_S	89_L	0.879	0.59
69_K	90_S	0.865	0.58
58_R	68_K	0.845	0.56
52_L	86_L	0.839	0.56
36_Y	88_E	0.838	0.56
16_G	69_K	0.829	0.55
45_F	52_L	0.820	0.54
5_W	40_K	0.817	0.54
9_D	87_F	0.810	0.53
79_S	83_D	0.809	0.53
15_Q	85_K	0.803	0.53
14_L	89_L	0.788	0.51
6_S	40_K	0.788	0.51
32_T	47_V	0.787	0.51
49_K	87_F	0.786	0.51
2_Q	58_R	0.782	0.51
20_Y	47_V	0.781	0.51
80_K	90_S	0.777	0.50
18_I	43_L	0.769	0.49
76_P	83_D	0.766	0.49
14_L	90_S	0.757	0.48
8_E	79_S	0.754	0.48
13_I	32_T	0.732	0.46
62_K	88_E	0.728	0.46
31_D	56_I	0.727	0.46
36_Y	65_N	0.722	0.45
4_L	45_F	0.720	0.45
40_K	51_Q	0.715	0.45
57_R	60_K	0.711	0.44
67_V	73_G	0.707	0.44
33_D	77_S	0.704	0.44
3_R	66_N	0.696	0.43
65_N	83_D	0.692	0.42
13_I	86_L	0.687	0.42
61_K	68_K	0.682	0.42
78_F	81_P	0.674	0.41
41_G	60_K	0.670	0.41
27_S	51_Q	0.661	0.40
67_V	84_Q	0.656	0.39
9_D	35_F	0.653	0.39
7_E	44_S	0.650	0.39
21_R	84_Q	0.640	0.38
64_R	95_G	0.619	0.36
61_K	65_N	0.618	0.36
23_K	84_Q	0.616	0.36
28_P	41_G	0.611	0.35
13_I	36_Y	0.605	0.35
35_F	38_F	0.601	0.35
70_I	89_L	0.597	0.34
14_L	83_D	0.595	0.34
49_K	53_V	0.585	0.33
39_I	69_K	0.582	0.33
35_F	93_I	0.581	0.33
36_Y	83_D	0.580	0.33
16_G	62_K	0.579	0.33
74_K	95_G	0.571	0.32
19_D	22_A	0.571	0.32
9_D	40_K	0.568	0.32
10_E	52_L	0.562	0.31
13_I	21_R	0.562	0.31
46_D	60_K	0.541	0.30
40_K	91_K	0.531	0.29
66_N	90_S	0.531	0.29
61_K	75_D	0.527	0.29
2_Q	7_E	0.526	0.29
52_L	87_F	0.523	0.28
21_R	47_V	0.521	0.28
23_K	45_F	0.521	0.28
16_G	20_Y	0.515	0.28
36_Y	52_L	0.511	0.28
30_P	89_L	0.506	0.27
35_F	51_Q	0.503	0.27
60_K	95_G	0.500	0.27

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ebiA	1	0.8526	86.5	0.822	Contact Map
2ckxA	1	0.8421	46.7	0.869	Contact Map
3osgA	1	0.5474	32.2	0.88	Contact Map
2yumA	1	0.7263	31.5	0.88	Contact Map
2yusA	1	0.6421	30.3	0.881	Contact Map
2elkA	1	0.5368	29.8	0.882	Contact Map
2k9nA	1	0.5895	28.4	0.883	Contact Map
3sjmA	1	0.5684	25.6	0.886	Contact Map
2lr8A	1	0.6105	24.9	0.887	Contact Map
1ug2A	1	0.6737	23.5	0.888	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.