DUF544 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF544 - Protein of unknown function (DUF544)

PFAM:	PF04424	Sequences: CNVLLLRGKIELLPPDREQVSLELLLELLADELLSSNPLNYEQNISDALSFLPKLHTGLDVNPRFTGVDDFEYTPELALFDLLGIPLVHGWLVDPQDAETAAAVGAKSYNQLVELLI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	117 (116)
Sequences:	568 (435)
Seq/√Len:	40.4
META:	0.255

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
110_N	113_V	3.071	1.00
97_D	100_T	3.013	1.00
58_G	62_N	2.405	1.00
104_V	112_L	2.401	1.00
106_A	112_L	2.370	1.00
2_N	6_L	2.345	1.00
73_Y	81_D	2.212	1.00
58_G	91_W	2.184	0.99
72_E	110_N	2.175	0.99
68_V	88_V	2.140	0.99
47_D	72_E	2.086	0.99
22_L	56_H	1.987	0.99
26_L	55_L	1.957	0.99
100_T	103_A	1.907	0.99
62_N	72_E	1.902	0.98
74_T	81_D	1.822	0.98
54_K	76_E	1.804	0.98
66_T	70_D	1.771	0.98
111_Q	114_E	1.728	0.97
49_L	53_P	1.621	0.96
51_F	80_F	1.569	0.95
69_D	86_P	1.560	0.95
61_V	85_I	1.536	0.94
97_D	103_A	1.530	0.94
17_R	33_L	1.516	0.94
1_C	9_K	1.513	0.94
99_E	102_A	1.490	0.93
17_R	24_L	1.474	0.93
20_V	25_L	1.438	0.92
79_L	93_V	1.409	0.91
55_L	83_L	1.407	0.91
41_Y	44_N	1.388	0.91
101_A	105_G	1.383	0.91
29_L	83_L	1.374	0.90
101_A	104_V	1.371	0.90
47_D	62_N	1.301	0.88
21_S	29_L	1.298	0.88
107_K	115_L	1.258	0.86
62_N	91_W	1.242	0.85
61_V	108_S	1.235	0.85
72_E	81_D	1.211	0.84
29_L	85_I	1.205	0.83
66_T	92_L	1.179	0.82
29_L	57_T	1.172	0.82
62_N	81_D	1.172	0.82
70_D	116_L	1.161	0.81
37_N	41_Y	1.161	0.81
14_P	22_L	1.136	0.79
37_N	84_G	1.136	0.79
52_L	82_L	1.128	0.79
29_L	52_L	1.113	0.78
56_H	63_P	1.094	0.77
53_P	59_L	1.093	0.77
30_A	52_L	1.088	0.76
51_F	78_A	1.088	0.76
67_G	70_D	1.073	0.75
48_A	63_P	1.055	0.74
79_L	83_L	1.054	0.74
63_P	115_L	1.051	0.74
81_D	110_N	1.049	0.74
105_G	112_L	1.044	0.73
24_L	33_L	1.037	0.73
59_L	63_P	1.026	0.72
25_L	47_D	1.023	0.72
83_L	112_L	1.013	0.71
21_S	33_L	1.011	0.71
58_G	110_N	0.999	0.70
60_D	113_V	0.992	0.69
62_N	109_Y	0.985	0.69
20_V	24_L	0.973	0.68
48_A	82_L	0.961	0.67
93_V	101_A	0.953	0.66
40_N	44_N	0.930	0.64
55_L	61_V	0.922	0.64
5_L	17_R	0.920	0.64
102_A	107_K	0.916	0.63
107_K	111_Q	0.915	0.63
25_L	95_P	0.911	0.63
40_N	43_Q	0.897	0.62
5_L	13_L	0.878	0.60
113_V	116_L	0.869	0.59
69_D	92_L	0.866	0.59
34_L	37_N	0.863	0.59
97_D	102_A	0.858	0.58
67_G	106_A	0.854	0.58
60_D	73_Y	0.852	0.58
36_S	65_F	0.844	0.57
61_V	87_L	0.833	0.56
21_S	25_L	0.821	0.55
31_D	46_S	0.816	0.54
43_Q	85_I	0.811	0.54
70_D	105_G	0.810	0.54
15_P	45_I	0.780	0.51
60_D	72_E	0.776	0.51
5_L	23_E	0.768	0.50
80_F	94_D	0.766	0.50
78_A	81_D	0.763	0.49
7_R	12_L	0.755	0.49
59_L	68_V	0.743	0.48
81_D	112_L	0.743	0.48
38_P	92_L	0.742	0.47
60_D	110_N	0.740	0.47
110_N	114_E	0.728	0.46
64_R	74_T	0.713	0.45
13_L	52_L	0.711	0.45
98_A	104_V	0.708	0.44
29_L	49_L	0.704	0.44
5_L	12_L	0.703	0.44
22_L	26_L	0.701	0.44
18_E	74_T	0.700	0.44
55_L	108_S	0.698	0.43
66_T	111_Q	0.698	0.43
16_D	63_P	0.695	0.43
5_L	10_I	0.693	0.43
57_T	69_D	0.693	0.43
44_N	72_E	0.682	0.42
44_N	57_T	0.677	0.42
53_P	80_F	0.675	0.41
31_D	60_D	0.671	0.41
57_T	71_F	0.660	0.40
48_A	51_F	0.660	0.40
29_L	64_R	0.657	0.40
38_P	109_Y	0.653	0.39
22_L	83_L	0.650	0.39
60_D	65_F	0.650	0.39
70_D	77_L	0.648	0.39
73_Y	110_N	0.642	0.38
85_I	106_A	0.641	0.38
42_E	84_G	0.634	0.38
5_L	21_S	0.630	0.37
30_A	49_L	0.623	0.37
60_D	81_D	0.619	0.37
3_V	7_R	0.616	0.36
100_T	106_A	0.615	0.36
92_L	95_P	0.604	0.35
66_T	93_V	0.601	0.35
70_D	88_V	0.600	0.35
27_E	30_A	0.599	0.35
24_L	112_L	0.599	0.35
96_Q	105_G	0.589	0.34
48_A	113_V	0.588	0.34
49_L	54_K	0.587	0.34
58_G	74_T	0.586	0.34
105_G	111_Q	0.584	0.34
98_A	102_A	0.580	0.33
99_E	104_V	0.575	0.33
18_E	21_S	0.575	0.33
71_F	75_P	0.566	0.32
44_N	88_V	0.560	0.32
35_S	86_P	0.557	0.31
21_S	87_L	0.555	0.31
51_F	56_H	0.552	0.31
59_L	80_F	0.550	0.31
37_N	70_D	0.544	0.30
102_A	105_G	0.544	0.30
83_L	105_G	0.538	0.30
9_K	88_V	0.535	0.30
56_H	84_G	0.534	0.30
12_L	93_V	0.534	0.30
51_F	55_L	0.530	0.29
19_Q	60_D	0.526	0.29
47_D	55_L	0.524	0.29
45_I	106_A	0.522	0.29
46_S	73_Y	0.521	0.29
20_V	98_A	0.521	0.29
60_D	76_E	0.519	0.28
29_L	46_S	0.516	0.28
98_A	101_A	0.513	0.28
1_C	10_I	0.512	0.28
24_L	31_D	0.507	0.28
83_L	104_V	0.505	0.27
45_I	96_Q	0.502	0.27
65_F	93_V	0.500	0.27
35_S	38_P	0.500	0.27

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ynaA	2	0.735	16.2	0.918	Contact Map
3d23B	4	0.7094	14	0.92	Contact Map
1lvoA	5	0.7265	6.3	0.932	Contact Map
3tloA	2	0.7265	6.3	0.932	Contact Map
3kzpA	2	0.8205	5.7	0.933	Contact Map
1v95A	1	0.4872	5.3	0.934	Contact Map
2mn2A	1	0.3419	5.1	0.935	Contact Map
3tntA	2	0.7265	4.8	0.936	Contact Map
4rniA	2	0.8974	4.5	0.936	Contact Map
3rznA	2	0.8974	3.9	0.938	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.