PTPLA - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PTPLA - Protein tyrosine phosphatase-like protein, PTPLA

PFAM:	PF04387	Sequences: QTLAVLEVLHALLGLVRSPVLTTLMQVASRLFVVWGILYSFPEVQSSSPGVFLLLLAWSITEVIRYSFYALNLALGKVPYWLTWLRYTLFIVLYPLGISSELLLIYAALPYAKETGLYSISLPNKWNFSFSYYYFLIALLLLYIPGFPVLYTHMLKQRKKVLGK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	164 (161)
Sequences:	1111 (825)
Seq/√Len:	65.0
META:	0.291

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
91_I	155_L	4.720	1.00
85_L	89_L	4.343	1.00
98_I	147_F	4.277	1.00
2_T	35_W	4.006	1.00
57_A	96_L	3.978	1.00
124_N	127_N	3.474	1.00
53_L	100_S	3.304	1.00
61_T	89_L	3.239	1.00
88_T	162_L	2.990	1.00
64_I	89_L	2.792	1.00
102_L	140_L	2.663	1.00
148_P	152_T	2.509	1.00
9_L	13_L	2.423	1.00
5_V	31_L	2.292	1.00
6_L	10_H	2.138	1.00
50_G	103_L	2.074	1.00
116_G	121_S	2.059	1.00
123_P	127_N	2.057	1.00
11_A	20_V	1.986	1.00
33_V	54_L	1.915	1.00
38_L	54_L	1.907	1.00
151_Y	155_L	1.763	1.00
19_P	153_H	1.762	1.00
152_T	155_L	1.743	1.00
8_V	28_A	1.707	0.99
4_A	7_E	1.640	0.99
68_F	83_T	1.613	0.99
122_L	127_N	1.563	0.99
153_H	157_Q	1.558	0.99
141_L	144_I	1.555	0.99
124_N	130_F	1.552	0.99
88_T	91_I	1.549	0.99
26_Q	94_Y	1.499	0.99
127_N	130_F	1.485	0.98
109_L	137_I	1.482	0.98
61_T	64_I	1.443	0.98
105_I	136_L	1.428	0.98
8_V	24_L	1.406	0.98
54_L	100_S	1.400	0.98
36_G	132_Y	1.375	0.97
29_S	98_I	1.336	0.97
5_V	8_V	1.332	0.97
84_W	88_T	1.313	0.97
83_T	162_L	1.305	0.96
98_I	150_L	1.295	0.96
56_L	59_S	1.280	0.96
137_I	141_L	1.277	0.96
24_L	28_A	1.271	0.96
132_Y	136_L	1.263	0.96
19_P	22_T	1.245	0.95
11_A	19_P	1.239	0.95
140_L	144_I	1.213	0.95
86_R	97_G	1.195	0.94
14_G	17_R	1.194	0.94
50_G	100_S	1.194	0.94
21_L	25_M	1.178	0.94
12_L	20_V	1.160	0.93
90_F	151_Y	1.157	0.93
133_Y	137_I	1.142	0.93
18_S	69_Y	1.114	0.92
47_S	50_G	1.102	0.91
11_A	23_T	1.069	0.90
69_Y	73_L	1.058	0.90
80_Y	88_T	1.048	0.89
25_M	150_L	1.046	0.89
135_F	139_L	1.042	0.89
75_L	78_V	1.036	0.89
141_L	145_P	1.014	0.88
98_I	143_Y	1.006	0.87
134_Y	138_A	1.004	0.87
5_V	24_L	0.977	0.85
103_L	107_A	0.961	0.85
150_L	154_M	0.949	0.84
124_N	128_F	0.936	0.83
152_T	156_K	0.928	0.82
69_Y	87_Y	0.927	0.82
144_I	148_P	0.919	0.82
87_Y	97_G	0.917	0.82
53_L	96_L	0.913	0.81
51_V	55_L	0.907	0.81
62_E	67_S	0.906	0.81
69_Y	72_N	0.902	0.81
71_L	75_L	0.895	0.80
100_S	104_L	0.880	0.79
32_F	136_L	0.867	0.78
60_I	63_V	0.867	0.78
63_V	70_A	0.859	0.77
123_P	130_F	0.856	0.77
62_E	97_G	0.853	0.77
29_S	99_S	0.852	0.77
38_L	104_L	0.839	0.76
116_G	119_S	0.838	0.75
156_K	159_K	0.835	0.75
88_T	163_G	0.834	0.75
95_P	101_E	0.833	0.75
37_I	136_L	0.827	0.75
7_E	10_H	0.819	0.74
109_L	140_L	0.817	0.74
90_F	94_Y	0.815	0.73
153_H	156_K	0.808	0.73
32_F	135_F	0.803	0.72
18_S	23_T	0.801	0.72
116_G	131_S	0.801	0.72
81_W	162_L	0.792	0.71
44_V	47_S	0.783	0.70
50_G	53_L	0.773	0.69
68_F	72_N	0.770	0.69
147_F	151_Y	0.770	0.69
113_K	133_Y	0.767	0.69
10_H	84_W	0.765	0.69
29_S	143_Y	0.763	0.68
120_I	124_N	0.762	0.68
23_T	29_S	0.761	0.68
102_L	106_Y	0.759	0.68
123_P	126_W	0.752	0.67
41_F	112_A	0.750	0.67
123_P	131_S	0.749	0.67
71_L	78_V	0.748	0.67
4_A	16_V	0.748	0.67
20_V	24_L	0.748	0.67
59_S	63_V	0.743	0.66
35_W	39_Y	0.742	0.66
159_K	163_G	0.741	0.66
154_M	158_R	0.741	0.66
108_A	112_A	0.738	0.66
63_V	67_S	0.732	0.65
5_V	12_L	0.731	0.65
77_K	82_L	0.727	0.65
57_A	93_L	0.727	0.65
79_P	82_L	0.724	0.64
144_I	147_F	0.724	0.64
8_V	11_A	0.721	0.64
139_L	144_I	0.720	0.64
97_G	101_E	0.716	0.64
57_A	100_S	0.715	0.63
112_A	132_Y	0.714	0.63
124_N	131_S	0.711	0.63
109_L	133_Y	0.710	0.63
61_T	155_L	0.710	0.63
86_R	101_E	0.702	0.62
69_Y	97_G	0.695	0.61
88_T	151_Y	0.695	0.61
140_L	143_Y	0.689	0.61
123_P	129_S	0.686	0.60
64_I	85_L	0.684	0.60
99_S	103_L	0.682	0.60
102_L	144_I	0.679	0.59
90_F	95_P	0.675	0.59
28_A	31_L	0.670	0.58
68_F	161_V	0.669	0.58
83_T	161_V	0.669	0.58
12_L	45_Q	0.668	0.58
93_L	154_M	0.667	0.58
34_V	61_T	0.667	0.58
58_W	101_E	0.663	0.58
67_S	81_W	0.661	0.57
29_S	62_E	0.659	0.57
52_F	55_L	0.654	0.57
71_L	77_K	0.654	0.57
60_I	99_S	0.652	0.56
147_F	150_L	0.651	0.56
1_Q	7_E	0.648	0.56
26_Q	29_S	0.639	0.55
41_F	104_L	0.639	0.55
116_G	122_L	0.638	0.55
71_L	134_Y	0.636	0.54
90_F	143_Y	0.634	0.54
13_L	20_V	0.633	0.54
9_L	77_K	0.632	0.54
37_I	105_I	0.628	0.54
1_Q	4_A	0.627	0.53
100_S	103_L	0.626	0.53
66_Y	69_Y	0.623	0.53
123_P	128_F	0.622	0.53
120_I	126_W	0.620	0.53
111_Y	114_E	0.620	0.53
156_K	160_K	0.615	0.52
16_V	27_V	0.612	0.52
15_L	24_L	0.611	0.52
134_Y	137_I	0.610	0.51
100_S	145_P	0.608	0.51
16_V	62_E	0.606	0.51
29_S	154_M	0.606	0.51
18_S	30_R	0.604	0.51
57_A	61_T	0.601	0.50
119_S	125_K	0.599	0.50
87_Y	101_E	0.593	0.49
116_G	137_I	0.587	0.49
8_V	20_V	0.586	0.49
98_I	102_L	0.584	0.48
34_V	51_V	0.584	0.48
35_W	41_F	0.578	0.48
29_S	61_T	0.578	0.48
38_L	51_V	0.576	0.47
93_L	97_G	0.575	0.47
76_G	135_F	0.575	0.47
67_S	72_N	0.572	0.47
103_L	135_F	0.571	0.47
120_I	125_K	0.567	0.46
113_K	137_I	0.563	0.46
64_I	150_L	0.562	0.46
17_R	46_S	0.561	0.46
9_L	129_S	0.560	0.46
41_F	117_L	0.558	0.45
140_L	148_P	0.556	0.45
37_I	41_F	0.556	0.45
72_N	99_S	0.556	0.45
89_L	92_V	0.555	0.45
50_G	104_L	0.553	0.45
112_A	136_L	0.553	0.45
19_P	23_T	0.547	0.44
26_Q	90_F	0.546	0.44
10_H	15_L	0.546	0.44
112_A	133_Y	0.541	0.43
2_T	39_Y	0.538	0.43
139_L	143_Y	0.538	0.43
85_L	98_I	0.534	0.43
157_Q	162_L	0.533	0.43
1_Q	26_Q	0.532	0.42
120_I	123_P	0.531	0.42
56_L	60_I	0.531	0.42
47_S	70_A	0.530	0.42
114_E	117_L	0.529	0.42
4_A	23_T	0.529	0.42
127_N	131_S	0.528	0.42
79_P	90_F	0.527	0.42
115_T	118_Y	0.527	0.42
1_Q	58_W	0.524	0.41
79_P	83_T	0.522	0.41
91_I	151_Y	0.519	0.41
110_P	113_K	0.513	0.40
9_L	21_L	0.513	0.40
87_Y	90_F	0.509	0.40
73_L	145_P	0.508	0.40
117_L	146_G	0.507	0.40
34_V	161_V	0.506	0.39
33_V	105_I	0.506	0.39
90_F	155_L	0.505	0.39
55_L	161_V	0.505	0.39
131_S	134_Y	0.504	0.39
139_L	142_L	0.503	0.39
149_V	152_T	0.500	0.39

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3tz1B	1	0.0732	6.1	0.953	Contact Map
4b19A	1	0.1829	3.3	0.959	Contact Map
2rddB	1	0.2012	2	0.963	Contact Map
2kpaA	1	0.1159	1.9	0.964	Contact Map
2maeA	1	0.061	1.9	0.964	Contact Map
2mw3A	1	0.128	1.5	0.966	Contact Map
1jb0I	1	0.2317	1.3	0.967	Contact Map
4r1dB	1	0.3537	1.2	0.967	Contact Map
2ja2A	1	0.2561	1.1	0.968	Contact Map
4he8A	1	0.1829	1.1	0.969	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.