FAINT - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FAINT - Domain of unknown function, DUF529

PFAM:	PF04385	Sequences: TLDISKPDSSDFFVYEYVSDGVNVKTYTPKDGYKFTKVVDGDKVIWKAKDDEECSLVVVYYKDGKKNFLVLLLTNNMF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	78 (72)
Sequences:	1539 (1409)
Seq/√Len:	166.1
META:	0.001

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
44_V	47_K	3.005	1.00
54_C	57_V	2.713	1.00
29_P	35_F	2.638	1.00
37_K	47_K	2.458	1.00
12_F	15_Y	2.275	1.00
37_K	44_V	2.220	1.00
55_S	58_V	2.045	1.00
8_D	11_D	1.950	1.00
71_L	74_T	1.637	1.00
9_S	13_F	1.625	1.00
48_A	54_C	1.538	1.00
68_F	74_T	1.499	1.00
69_L	74_T	1.489	1.00
56_L	59_V	1.484	1.00
68_F	73_L	1.386	1.00
57_V	60_Y	1.381	1.00
9_S	14_V	1.371	1.00
63_D	66_K	1.349	1.00
8_D	13_F	1.333	1.00
68_F	72_L	1.331	1.00
35_F	55_S	1.254	1.00
20_D	24_V	1.247	1.00
54_C	61_Y	1.239	1.00
13_F	16_E	1.235	1.00
39_V	44_V	1.219	1.00
8_D	14_V	1.212	1.00
39_V	45_I	1.184	1.00
50_D	53_E	1.168	1.00
7_P	12_F	1.161	1.00
8_D	12_F	1.157	1.00
8_D	16_E	1.156	1.00
7_P	13_F	1.138	1.00
59_V	62_K	1.136	1.00
25_K	28_T	1.108	1.00
7_P	10_S	1.104	1.00
5_S	40_D	1.090	1.00
9_S	16_E	1.085	1.00
46_W	59_V	1.052	0.99
3_D	6_K	1.045	0.99
29_P	34_K	1.039	0.99
48_A	51_D	1.004	0.99
57_V	61_Y	0.997	0.99
52_E	55_S	0.983	0.99
70_V	73_L	0.982	0.99
10_S	15_Y	0.950	0.99
54_C	59_V	0.948	0.99
60_Y	66_K	0.926	0.99
57_V	63_D	0.924	0.99
39_V	43_K	0.900	0.98
10_S	14_V	0.897	0.98
69_L	72_L	0.897	0.98
52_E	65_K	0.867	0.98
23_N	27_Y	0.865	0.98
9_S	12_F	0.838	0.97
58_V	61_Y	0.823	0.97
40_D	45_I	0.820	0.97
61_Y	66_K	0.807	0.96
13_F	30_K	0.792	0.96
17_Y	24_V	0.791	0.96
24_V	45_I	0.790	0.96
8_D	15_Y	0.762	0.95
6_K	12_F	0.761	0.95
6_K	10_S	0.756	0.95
27_Y	38_V	0.746	0.95
69_L	73_L	0.745	0.95
47_K	52_E	0.744	0.95
64_G	70_V	0.741	0.94
52_E	57_V	0.739	0.94
36_T	48_A	0.735	0.94
45_I	74_T	0.735	0.94
11_D	16_E	0.721	0.94
29_P	48_A	0.716	0.93
24_V	42_D	0.715	0.93
11_D	15_Y	0.708	0.93
23_N	68_F	0.696	0.92
25_K	40_D	0.689	0.92
59_V	63_D	0.684	0.92
21_G	25_K	0.681	0.91
7_P	11_D	0.679	0.91
27_Y	59_V	0.676	0.91
23_N	26_T	0.671	0.91
24_V	65_K	0.661	0.90
35_F	40_D	0.650	0.89
10_S	13_F	0.640	0.89
55_S	60_Y	0.624	0.88
11_D	14_V	0.619	0.87
29_P	33_Y	0.618	0.87
40_D	43_K	0.612	0.87
49_K	56_L	0.610	0.86
16_E	23_N	0.593	0.85
51_D	55_S	0.591	0.85
43_K	72_L	0.590	0.84
54_C	58_V	0.579	0.83
19_S	22_V	0.578	0.83
2_L	74_T	0.570	0.82
31_D	44_V	0.562	0.82
48_A	52_E	0.560	0.81
29_P	38_V	0.550	0.80
31_D	36_T	0.537	0.79
17_Y	28_T	0.534	0.78
8_D	32_G	0.524	0.77
43_K	50_D	0.519	0.76
44_V	51_D	0.516	0.76
20_D	23_N	0.506	0.74
13_F	22_V	0.503	0.74
27_Y	44_V	0.501	0.74
51_D	54_C	0.500	0.74
62_K	66_K	0.500	0.74

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ic8A	3	0.4872	2.9	0.843	Contact Map
1gqpA	2	0.9487	2.8	0.844	Contact Map
3izxB	7	0.9359	1.9	0.857	Contact Map
1h7zA	3	0.4615	1.6	0.863	Contact Map
4lo0C	1	0.6923	1.1	0.876	Contact Map
3v42A	2	0.8462	1.1	0.877	Contact Map
1k7hA	2	0.5	1.1	0.877	Contact Map
1kqrA	1	0.9744	1	0.878	Contact Map
2hzdA	1	0.5256	1	0.878	Contact Map
2nykA	1	0.8205	0.9	0.881	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.