ATE_N - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ATE_N - Arginine-tRNA-protein transferase, N terminus

PFAM:	PF04376	Sequences: TAPHPCPYLPGRQARKLFTDPSGPISYGFLAERLAPALYDALLRAGFRRSGNFLYRPACEPGCRACVPVRVPVAEFRPSRSQRR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	84 (72)
Sequences:	10324 (5044)
Seq/√Len:	594.4
META:	0.876

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
72_P	75_E	5.018	1.00
50_S	55_Y	2.862	1.00
78_P	82_Q	2.596	1.00
39_Y	43_L	2.377	1.00
15_R	61_P	2.326	1.00
79_S	82_Q	2.298	1.00
12_R	65_A	2.271	1.00
4_H	14_A	2.234	1.00
41_A	45_A	2.065	1.00
40_D	44_R	2.029	1.00
76_F	82_Q	1.992	1.00
3_P	13_Q	1.991	1.00
17_L	58_A	1.847	1.00
9_L	12_R	1.832	1.00
40_D	43_L	1.828	1.00
46_G	68_P	1.727	1.00
59_C	66_C	1.642	1.00
34_L	54_L	1.541	1.00
35_A	38_L	1.536	1.00
3_P	61_P	1.524	1.00
17_L	56_R	1.522	1.00
3_P	15_R	1.503	1.00
12_R	62_G	1.352	1.00
64_R	67_V	1.275	1.00
5_P	13_Q	1.254	1.00
58_A	61_P	1.187	1.00
78_P	83_R	1.147	1.00
7_P	14_A	1.128	1.00
4_H	16_K	1.096	1.00
81_S	84_R	1.046	1.00
20_D	23_G	1.032	1.00
9_L	65_A	1.020	1.00
42_L	47_F	1.012	1.00
4_H	7_P	1.009	1.00
5_P	11_G	1.000	1.00
14_A	57_P	0.987	1.00
19_T	23_G	0.935	1.00
36_P	40_D	0.920	1.00
49_R	55_Y	0.879	1.00
5_P	10_P	0.858	1.00
41_A	44_R	0.837	1.00
48_R	66_C	0.828	1.00
23_G	35_A	0.818	1.00
40_D	46_G	0.804	1.00
20_D	24_P	0.797	1.00
19_T	47_F	0.773	1.00
58_A	64_R	0.771	1.00
20_D	51_G	0.760	1.00
48_R	55_Y	0.759	1.00
37_A	41_A	0.732	1.00
22_S	41_A	0.723	1.00
49_R	68_P	0.722	1.00
20_D	52_N	0.695	1.00
38_L	41_A	0.690	1.00
18_F	21_P	0.681	1.00
42_L	54_L	0.679	1.00
77_R	80_R	0.677	1.00
71_V	76_F	0.674	1.00
36_P	39_Y	0.672	1.00
47_F	68_P	0.670	1.00
78_P	81_S	0.668	1.00
39_Y	51_G	0.664	1.00
16_K	57_P	0.661	1.00
13_Q	61_P	0.655	1.00
21_P	34_L	0.641	1.00
22_S	52_N	0.636	1.00
15_R	58_A	0.635	1.00
9_L	69_V	0.626	1.00
22_S	45_A	0.625	1.00
4_H	51_G	0.624	1.00
50_S	54_L	0.624	1.00
74_A	77_R	0.621	1.00
23_G	45_A	0.619	1.00
66_C	84_R	0.611	1.00
39_Y	69_V	0.610	1.00
23_G	52_N	0.608	1.00
39_Y	67_V	0.594	1.00
47_F	50_S	0.588	1.00
19_T	54_L	0.587	1.00
24_P	77_R	0.587	1.00
50_S	68_P	0.587	1.00
47_F	55_Y	0.577	1.00
14_A	21_P	0.572	1.00
46_G	50_S	0.568	1.00
43_L	54_L	0.563	1.00
59_C	84_R	0.562	1.00
39_Y	54_L	0.560	1.00
48_R	68_P	0.556	0.99
16_K	51_G	0.554	0.99
14_A	51_G	0.550	0.99
59_C	62_G	0.550	0.99
50_S	57_P	0.549	0.99
20_D	45_A	0.544	0.99
20_D	43_L	0.544	0.99
66_C	71_V	0.531	0.99
39_Y	56_R	0.529	0.99
42_L	45_A	0.527	0.99
7_P	54_L	0.523	0.99
42_L	50_S	0.521	0.99
23_G	58_A	0.520	0.99
57_P	66_C	0.517	0.99
24_P	34_L	0.513	0.99
59_C	65_A	0.511	0.99
62_G	77_R	0.511	0.99
18_F	51_G	0.511	0.99
9_L	42_L	0.505	0.99
10_P	13_Q	0.500	0.99
18_F	53_F	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1d2vC	2	0.3214	11.7	0.892	Contact Map
4un4B	1	0.8095	3.7	0.914	Contact Map
2m4gA	1	0.6429	3.1	0.917	Contact Map
3mhsC	1	0.3333	2.9	0.919	Contact Map
2dvjA	1	0.7857	2.7	0.92	Contact Map
1kptA	2	0.6905	2.6	0.92	Contact Map
2jvmA	1	0.3571	2.2	0.924	Contact Map
3m7kA	2	0.9048	2.2	0.924	Contact Map
3mazA	1	0.7143	2.1	0.924	Contact Map
3zmsC	1	0	2	0.925	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.