DUF485 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF485 - Protein of unknown function, DUF485

PFAM:	PF04341	Sequences: QASPEFQELVRRRRRFAWPLTAAFLVWYFGFILLVAFAPDFMATKVGPGVINVGILLGLGQFVSTWVLTGIYVRRANREFDPLAAEIRE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	89 (86)
Sequences:	11315 (5643)
Seq/√Len:	608.5
META:	0.838

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
38_A	41_F	2.787	1.00
5_E	86_E	2.779	1.00
27_W	64_S	2.671	1.00
8_E	12_R	2.465	1.00
83_L	86_E	1.898	1.00
46_V	56_L	1.827	1.00
41_F	53_V	1.749	1.00
14_R	18_W	1.724	1.00
82_P	86_E	1.720	1.00
67_V	71_I	1.706	1.00
12_R	79_E	1.697	1.00
11_R	15_R	1.692	1.00
78_R	82_P	1.684	1.00
75_R	80_F	1.605	1.00
27_W	60_G	1.581	1.00
18_W	22_A	1.549	1.00
26_V	30_G	1.517	1.00
33_L	37_F	1.516	1.00
8_E	83_L	1.487	1.00
70_G	74_R	1.432	1.00
74_R	78_R	1.429	1.00
75_R	79_E	1.417	1.00
16_F	75_R	1.390	1.00
85_A	88_R	1.337	1.00
41_F	44_T	1.337	1.00
27_W	61_Q	1.319	1.00
24_F	68_L	1.276	1.00
36_A	39_P	1.259	1.00
84_A	88_R	1.235	1.00
12_R	83_L	1.221	1.00
76_A	80_F	1.210	1.00
16_F	20_L	1.209	1.00
34_L	57_L	1.192	1.00
33_L	38_A	1.178	1.00
15_R	19_P	1.159	1.00
34_L	38_A	1.157	1.00
5_E	8_E	1.145	1.00
40_D	43_A	1.143	1.00
22_A	26_V	1.121	1.00
80_F	84_A	1.114	1.00
13_R	17_A	1.110	1.00
25_L	29_F	1.099	1.00
19_P	23_A	1.090	1.00
35_V	42_M	1.064	1.00
79_E	83_L	1.063	1.00
73_V	77_N	1.063	1.00
51_I	56_L	1.049	1.00
79_E	82_P	1.038	1.00
44_T	53_V	1.020	1.00
46_V	53_V	1.005	1.00
4_P	8_E	1.003	1.00
60_G	64_S	0.985	1.00
45_K	50_V	0.982	1.00
20_L	71_I	0.979	1.00
82_P	85_A	0.966	1.00
2_A	7_Q	0.961	1.00
34_L	42_M	0.936	1.00
69_T	73_V	0.927	1.00
67_V	70_G	0.921	1.00
10_V	14_R	0.919	1.00
74_R	79_E	0.892	1.00
63_V	67_V	0.890	1.00
75_R	78_R	0.889	1.00
20_L	68_L	0.887	1.00
21_T	24_F	0.884	1.00
53_V	57_L	0.866	1.00
19_P	22_A	0.849	1.00
7_Q	10_V	0.847	1.00
64_S	68_L	0.834	1.00
28_Y	65_T	0.833	1.00
7_Q	11_R	0.828	1.00
23_A	64_S	0.827	1.00
31_F	58_G	0.822	1.00
47_G	50_V	0.817	1.00
8_E	11_R	0.796	1.00
38_A	44_T	0.785	1.00
4_P	7_Q	0.779	1.00
71_I	75_R	0.771	1.00
42_M	57_L	0.769	1.00
11_R	14_R	0.766	1.00
47_G	51_I	0.761	1.00
24_F	65_T	0.756	1.00
34_L	41_F	0.748	1.00
26_V	29_F	0.739	1.00
70_G	73_V	0.735	1.00
40_D	44_T	0.734	1.00
45_K	52_N	0.717	1.00
3_S	7_Q	0.711	1.00
12_R	15_R	0.705	1.00
30_G	57_L	0.698	1.00
6_F	10_V	0.698	1.00
51_I	54_G	0.688	1.00
39_P	43_A	0.682	1.00
52_N	56_L	0.656	1.00
32_I	35_V	0.654	1.00
30_G	34_L	0.653	1.00
71_I	77_N	0.645	1.00
7_Q	14_R	0.642	1.00
46_V	51_I	0.635	1.00
55_I	59_L	0.622	1.00
23_A	27_W	0.618	1.00
29_F	32_I	0.615	1.00
64_S	67_V	0.614	1.00
16_F	71_I	0.611	1.00
65_T	69_T	0.611	1.00
69_T	77_N	0.608	1.00
43_A	52_N	0.586	1.00
13_R	16_F	0.584	1.00
56_L	60_G	0.582	1.00
61_Q	65_T	0.571	1.00
54_G	58_G	0.570	1.00
9_L	83_L	0.569	1.00
51_I	55_I	0.569	1.00
31_F	65_T	0.566	1.00
55_I	58_G	0.566	1.00
36_A	55_I	0.566	1.00
28_Y	31_F	0.558	1.00
21_T	25_L	0.555	1.00
83_L	87_I	0.552	0.99
3_S	6_F	0.547	0.99
5_E	83_L	0.544	0.99
74_R	77_N	0.541	0.99
47_G	56_L	0.538	0.99
14_R	19_P	0.535	0.99
59_L	63_V	0.534	0.99
35_V	54_G	0.534	0.99
5_E	87_I	0.528	0.99
24_F	64_S	0.508	0.99
35_V	39_P	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4hkrA	3	0.9101	31.5	0.848	Contact Map
4ev6A	3	0.8539	17.8	0.865	Contact Map
4i0uA	4	0.8315	16.6	0.867	Contact Map
2onkC	2	0.8202	14.6	0.87	Contact Map
4djkA	2	0.8315	12.4	0.874	Contact Map
4he8M	1	0.9551	12.2	0.875	Contact Map
4he8N	1	0.9551	12	0.875	Contact Map
3rkoN	1	0.9213	11.1	0.877	Contact Map
2m20A	2	0.4831	11.1	0.877	Contact Map
3tx3A	2	0.8427	10.8	0.878	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.