IspA - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

IspA - Intracellular septation protein A

PFAM:	PF04279	Sequences: MKLLLDFGPLILFFVAYKLAGIYVATAVFIVATVAQLAVSWLRTRKVPKMPLVSLVLVVVFGGLTLLLHDETFIKWKPTIIYWLFAAVLLGGLLFGGKNLLKRLLGEALELPDEGWRKLNLRWALFFLALAALNEYVARNFSTDTWVNFKLFGLLGLTLVFALAQGPLLSRHLKEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	176 (172)
Sequences:	12056 (7241)
Seq/√Len:	552.1
META:	0.889

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
83_W	131_A	3.586	1.00
71_E	143_T	3.104	1.00
102_K	113_D	2.781	1.00
71_E	75_K	2.779	1.00
142_S	145_T	2.773	1.00
114_E	118_K	2.697	1.00
41_W	45_R	2.608	1.00
86_A	128_L	2.606	1.00
39_V	43_R	2.544	1.00
141_F	145_T	2.530	1.00
75_K	143_T	2.337	1.00
90_L	124_A	2.145	1.00
16_A	28_V	1.962	1.00
112_P	115_G	1.955	1.00
91_G	95_F	1.882	1.00
12_L	28_V	1.880	1.00
63_G	67_L	1.854	1.00
137_V	141_F	1.845	1.00
16_A	24_V	1.834	1.00
38_A	42_L	1.824	1.00
83_W	87_A	1.780	1.00
30_I	59_V	1.777	1.00
112_P	172_H	1.764	1.00
23_Y	66_L	1.722	1.00
136_Y	141_F	1.722	1.00
21_G	24_V	1.703	1.00
24_V	27_A	1.628	1.00
135_E	139_R	1.586	1.00
48_P	51_P	1.549	1.00
18_K	148_N	1.539	1.00
130_L	154_L	1.537	1.00
42_L	45_R	1.527	1.00
93_L	120_N	1.506	1.00
37_L	55_L	1.497	1.00
20_A	24_V	1.490	1.00
34_V	59_V	1.480	1.00
41_W	47_V	1.478	1.00
102_K	106_G	1.471	1.00
145_T	148_N	1.419	1.00
93_L	117_R	1.413	1.00
148_N	151_L	1.410	1.00
163_L	166_G	1.404	1.00
29_F	58_V	1.397	1.00
149_F	154_L	1.387	1.00
38_A	41_W	1.369	1.00
37_L	47_V	1.354	1.00
121_L	125_L	1.340	1.00
33_T	55_L	1.326	1.00
128_L	132_A	1.295	1.00
41_W	44_T	1.289	1.00
23_Y	69_H	1.285	1.00
22_I	74_I	1.276	1.00
83_W	128_L	1.264	1.00
132_A	136_Y	1.256	1.00
30_I	62_G	1.255	1.00
99_N	102_K	1.254	1.00
51_P	55_L	1.226	1.00
52_L	56_V	1.216	1.00
88_V	91_G	1.212	1.00
27_A	31_V	1.209	1.00
17_Y	143_T	1.199	1.00
95_F	98_K	1.191	1.00
34_V	55_L	1.187	1.00
148_N	152_F	1.183	1.00
167_P	170_S	1.176	1.00
14_F	18_K	1.173	1.00
100_L	103_R	1.161	1.00
117_R	121_L	1.160	1.00
136_Y	140_N	1.159	1.00
89_L	120_N	1.151	1.00
40_S	44_T	1.143	1.00
115_G	118_K	1.141	1.00
17_Y	147_V	1.131	1.00
166_G	170_S	1.125	1.00
99_N	120_N	1.105	1.00
89_L	101_L	1.096	1.00
153_G	156_G	1.094	1.00
152_F	156_G	1.092	1.00
125_L	129_A	1.089	1.00
26_T	62_G	1.083	1.00
87_A	91_G	1.081	1.00
161_F	165_Q	1.079	1.00
49_K	53_V	1.071	1.00
82_Y	154_L	1.061	1.00
163_L	167_P	1.058	1.00
15_V	19_L	1.056	1.00
115_G	168_L	1.054	1.00
10_L	151_L	1.041	1.00
26_T	65_T	1.021	1.00
64_L	68_L	1.020	1.00
98_K	103_R	1.019	1.00
40_S	51_P	1.010	1.00
75_K	138_A	0.999	1.00
159_L	162_A	0.989	1.00
105_L	108_A	0.989	1.00
47_V	52_L	0.984	1.00
118_K	168_L	0.980	1.00
137_V	149_F	0.979	1.00
12_L	32_A	0.976	1.00
90_L	121_L	0.970	1.00
135_E	138_A	0.956	1.00
113_D	117_R	0.952	1.00
155_L	158_T	0.949	1.00
35_A	39_V	0.947	1.00
92_G	100_L	0.941	1.00
164_A	167_P	0.924	1.00
28_V	31_V	0.923	1.00
76_W	139_R	0.922	1.00
162_A	166_G	0.922	1.00
34_V	38_A	0.921	1.00
118_K	121_L	0.915	1.00
90_L	94_L	0.900	1.00
72_T	76_W	0.892	1.00
54_S	58_V	0.886	1.00
94_L	97_G	0.885	1.00
7_F	10_L	0.882	1.00
86_A	90_L	0.873	1.00
29_F	74_I	0.871	1.00
137_V	140_N	0.870	1.00
39_V	42_L	0.868	1.00
79_T	134_N	0.865	1.00
30_I	34_V	0.864	1.00
90_L	125_L	0.860	1.00
89_L	100_L	0.856	1.00
88_V	100_L	0.853	1.00
168_L	172_H	0.852	1.00
126_F	161_F	0.850	1.00
158_T	162_A	0.848	1.00
99_N	103_R	0.843	1.00
137_V	145_T	0.843	1.00
86_A	124_A	0.842	1.00
144_D	148_N	0.841	1.00
170_S	173_L	0.831	1.00
24_V	28_V	0.831	1.00
53_V	57_L	0.826	1.00
159_L	163_L	0.822	1.00
64_L	73_F	0.819	1.00
122_R	165_Q	0.814	1.00
55_L	59_V	0.810	1.00
151_L	155_L	0.810	1.00
149_F	153_G	0.810	1.00
169_L	173_L	0.807	1.00
133_L	157_L	0.804	1.00
8_G	32_A	0.803	1.00
129_A	133_L	0.802	1.00
15_V	18_K	0.796	1.00
131_A	135_E	0.785	1.00
60_V	63_G	0.777	1.00
40_S	47_V	0.776	1.00
70_D	73_F	0.774	1.00
71_E	74_I	0.773	1.00
105_L	109_L	0.770	1.00
72_T	139_R	0.769	1.00
114_E	117_R	0.766	1.00
107_E	110_E	0.762	1.00
64_L	67_L	0.758	1.00
16_A	20_A	0.758	1.00
121_L	124_A	0.758	1.00
29_F	33_T	0.755	1.00
160_V	164_A	0.754	1.00
52_L	55_L	0.753	1.00
124_A	128_L	0.752	1.00
11_I	15_V	0.738	1.00
112_P	118_K	0.727	1.00
106_G	110_E	0.726	1.00
91_G	124_A	0.724	1.00
138_A	142_S	0.717	1.00
144_D	147_V	0.701	1.00
92_G	99_N	0.701	1.00
130_L	133_L	0.699	1.00
72_T	75_K	0.698	1.00
84_L	88_V	0.697	1.00
56_V	60_V	0.696	1.00
90_L	93_L	0.695	1.00
46_K	49_K	0.694	1.00
41_W	52_L	0.684	1.00
115_G	172_H	0.682	1.00
26_T	74_I	0.681	1.00
33_T	40_S	0.674	1.00
82_Y	130_L	0.667	1.00
33_T	58_V	0.666	1.00
76_W	135_E	0.665	1.00
117_R	120_N	0.661	1.00
162_A	169_L	0.658	1.00
16_A	25_A	0.654	1.00
23_Y	26_T	0.648	1.00
151_L	156_G	0.644	1.00
37_L	51_P	0.637	1.00
18_K	144_D	0.632	1.00
83_W	135_E	0.630	1.00
21_G	25_A	0.629	1.00
85_F	89_L	0.627	1.00
36_Q	40_S	0.627	1.00
167_P	171_R	0.625	1.00
93_L	99_N	0.624	1.00
123_W	165_Q	0.619	1.00
78_P	154_L	0.616	1.00
37_L	52_L	0.615	1.00
93_L	121_L	0.613	1.00
133_L	136_Y	0.611	1.00
156_G	160_V	0.611	1.00
153_G	157_L	0.609	1.00
57_L	61_F	0.607	1.00
81_I	85_F	0.604	1.00
29_F	32_A	0.603	1.00
89_L	92_G	0.599	1.00
27_A	66_L	0.598	1.00
122_R	161_F	0.597	1.00
82_Y	158_T	0.597	1.00
99_N	117_R	0.595	1.00
78_P	138_A	0.594	1.00
119_L	165_Q	0.593	1.00
61_F	81_I	0.589	1.00
54_S	81_I	0.586	1.00
85_F	127_F	0.583	1.00
26_T	66_L	0.581	1.00
17_Y	21_G	0.576	0.99
61_F	80_I	0.572	0.99
93_L	97_G	0.571	0.99
102_K	105_L	0.571	0.99
8_G	36_Q	0.570	0.99
68_L	73_F	0.569	0.99
23_Y	65_T	0.569	0.99
49_K	52_L	0.568	0.99
138_A	141_F	0.568	0.99
23_Y	27_A	0.565	0.99
133_L	149_F	0.565	0.99
98_K	102_K	0.561	0.99
123_W	162_A	0.561	0.99
5_L	8_G	0.556	0.99
14_F	151_L	0.554	0.99
122_R	168_L	0.550	0.99
79_T	135_E	0.546	0.99
126_F	157_L	0.545	0.99
33_T	37_L	0.542	0.99
41_W	46_K	0.540	0.99
133_L	137_V	0.537	0.99
10_L	14_F	0.537	0.99
129_A	157_L	0.536	0.99
31_V	35_A	0.536	0.99
14_F	152_F	0.531	0.99
30_I	66_L	0.528	0.99
30_I	33_T	0.528	0.99
84_L	87_A	0.525	0.99
122_R	125_L	0.524	0.99
89_L	124_A	0.524	0.99
32_A	36_Q	0.522	0.99
2_K	48_P	0.522	0.99
50_M	85_F	0.521	0.99
146_W	149_F	0.520	0.99
130_L	157_L	0.519	0.99
120_N	124_A	0.518	0.99
17_Y	144_D	0.517	0.99
148_N	153_G	0.514	0.99
3_L	7_F	0.512	0.99
79_T	132_A	0.509	0.99
76_W	80_I	0.502	0.99
22_I	143_T	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2xq2A	2	0.9034	24.2	0.916	Contact Map
3m73A	3	0.7216	3.8	0.942	Contact Map
3rceA	1	0.8182	3.7	0.943	Contact Map
1pi7A	1	0.108	3.2	0.944	Contact Map
2a65A	2	0.9602	3	0.945	Contact Map
3w4tA	1	0.9432	2.7	0.946	Contact Map
4lz6A	1	0.9545	2.6	0.947	Contact Map
2l2tA	2	0.1989	2.4	0.948	Contact Map
2m20A	2	0.1932	2.4	0.948	Contact Map
3wajA	1	0.9489	2.4	0.948	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.