MtrA - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MtrA - Tetrahydromethanopterin S-methyltransferase, subunit A

PFAM:	PF04208	Sequences: KKEPAEGWPPVPGEYVVGNPKSPVAVCTLGSHLLEKPLAEAGAAIVGTLKTENLGIEKIIANVISNPNIRFLILCGKESKGHLSGQSLLALHENGVDENGRIIGAKGAIPFLENLPKEAIERFRKQVELVDLIGEEDPEEIRAKIKELAAKDPGAFEEEPMVIEIKEEGEEEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	173 (152)
Sequences:	1531 (944)
Seq/√Len:	76.5
META:	0.933

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
94_N	104_G	4.395	1.00
87_S	102_I	3.646	1.00
89_L	131_D	3.247	1.00
121_E	125_K	3.049	1.00
92_H	129_L	2.931	1.00
86_Q	106_K	2.886	1.00
121_E	124_R	2.838	1.00
144_K	147_E	2.762	1.00
132_L	144_K	2.577	1.00
27_C	49_L	2.360	1.00
92_H	123_F	2.352	1.00
89_L	129_L	2.291	1.00
128_E	151_K	2.260	1.00
86_Q	90_A	2.079	1.00
92_H	124_R	2.035	1.00
71_F	130_V	1.985	1.00
52_E	82_H	1.962	1.00
137_D	140_E	1.936	1.00
117_K	121_E	1.917	1.00
63_V	123_F	1.905	1.00
135_E	140_E	1.871	1.00
74_L	129_L	1.866	1.00
63_V	72_L	1.811	1.00
52_E	110_P	1.771	1.00
61_A	119_A	1.744	1.00
83_L	106_K	1.715	1.00
87_S	105_A	1.684	1.00
27_C	59_I	1.654	1.00
52_E	81_G	1.631	1.00
116_P	119_A	1.593	1.00
122_R	126_Q	1.573	0.99
96_V	120_I	1.571	0.99
60_I	115_L	1.556	0.99
26_V	43_A	1.551	0.99
49_L	59_I	1.482	0.99
59_I	88_L	1.456	0.99
74_L	89_L	1.448	0.99
71_F	148_L	1.432	0.99
140_E	144_K	1.403	0.99
51_T	114_N	1.402	0.99
28_T	31_S	1.354	0.98
91_L	123_F	1.343	0.98
23_P	153_P	1.321	0.98
30_G	79_S	1.317	0.98
73_I	132_L	1.308	0.98
86_Q	105_A	1.306	0.98
8_W	17_V	1.295	0.98
27_C	75_C	1.282	0.98
49_L	75_C	1.264	0.97
56_I	102_I	1.260	0.97
100_G	117_K	1.245	0.97
140_E	143_A	1.224	0.97
87_S	90_A	1.190	0.96
86_Q	107_G	1.186	0.96
18_G	22_S	1.169	0.96
34_L	38_L	1.167	0.96
11_V	58_K	1.128	0.95
50_K	109_I	1.127	0.95
73_I	148_L	1.110	0.95
57_E	114_N	1.090	0.94
23_P	71_F	1.077	0.94
71_F	154_G	1.075	0.94
75_C	135_E	1.073	0.93
132_L	141_I	1.066	0.93
25_A	45_I	1.064	0.93
51_T	54_L	1.058	0.93
144_K	148_L	1.053	0.93
42_G	146_K	1.053	0.93
72_L	127_V	1.045	0.93
96_V	117_K	1.044	0.93
96_V	100_G	1.042	0.92
143_A	147_E	1.032	0.92
41_A	142_R	1.022	0.92
142_R	145_I	1.019	0.92
62_N	66_N	0.999	0.91
26_V	145_I	0.995	0.91
54_L	114_N	0.992	0.90
22_S	149_A	0.987	0.90
151_K	156_F	0.978	0.90
142_R	146_K	0.966	0.89
89_L	92_H	0.960	0.89
75_C	141_I	0.957	0.89
52_E	108_A	0.956	0.89
64_I	119_A	0.944	0.88
89_L	93_E	0.941	0.88
73_I	130_V	0.929	0.87
29_L	133_I	0.920	0.87
21_K	68_N	0.917	0.87
52_E	85_G	0.891	0.85
94_N	103_I	0.889	0.85
13_G	57_E	0.888	0.85
81_G	108_A	0.887	0.85
34_L	39_A	0.886	0.85
85_G	133_I	0.881	0.84
70_R	128_E	0.868	0.84
87_S	106_K	0.864	0.83
59_I	63_V	0.845	0.82
33_L	37_P	0.845	0.82
69_I	126_Q	0.843	0.82
72_L	91_L	0.840	0.81
45_I	53_N	0.839	0.81
151_K	154_G	0.815	0.79
43_A	46_V	0.813	0.79
118_E	128_E	0.809	0.79
70_R	126_Q	0.807	0.79
77_K	136_E	0.797	0.78
15_Y	45_I	0.778	0.76
98_E	117_K	0.778	0.76
69_I	143_A	0.776	0.76
7_G	117_K	0.770	0.76
50_K	54_L	0.769	0.75
64_I	115_L	0.767	0.75
64_I	126_Q	0.765	0.75
13_G	51_T	0.765	0.75
100_G	112_L	0.764	0.75
29_L	85_G	0.764	0.75
23_P	42_G	0.762	0.75
60_I	92_H	0.755	0.74
100_G	120_I	0.750	0.74
60_I	63_V	0.747	0.73
71_F	151_K	0.741	0.73
51_T	58_K	0.736	0.72
34_L	37_P	0.736	0.72
50_K	108_A	0.731	0.72
82_H	108_A	0.724	0.71
97_D	101_R	0.716	0.70
58_K	72_L	0.716	0.70
83_L	108_A	0.714	0.70
53_N	110_P	0.714	0.70
84_S	88_L	0.710	0.69
57_E	110_P	0.710	0.69
146_K	149_A	0.709	0.69
64_I	122_R	0.708	0.69
99_N	125_K	0.708	0.69
93_E	131_D	0.708	0.69
54_L	58_K	0.707	0.69
54_L	57_E	0.706	0.69
150_A	154_G	0.704	0.69
152_D	155_A	0.702	0.69
102_I	106_K	0.695	0.68
18_G	44_A	0.693	0.68
13_G	58_K	0.690	0.67
27_C	108_A	0.689	0.67
43_A	114_N	0.687	0.67
139_E	150_A	0.687	0.67
31_S	136_E	0.683	0.66
66_N	69_I	0.683	0.66
115_L	119_A	0.683	0.66
139_E	147_E	0.682	0.66
33_L	38_L	0.676	0.66
132_L	140_E	0.673	0.65
13_G	126_Q	0.673	0.65
81_G	126_Q	0.670	0.65
126_Q	156_F	0.664	0.64
101_R	111_F	0.661	0.64
14_E	50_K	0.654	0.63
49_L	128_E	0.649	0.63
18_G	75_C	0.644	0.62
57_E	115_L	0.640	0.61
19_N	22_S	0.639	0.61
86_Q	104_G	0.632	0.61
85_G	123_F	0.625	0.60
42_G	68_N	0.619	0.59
25_A	53_N	0.618	0.59
52_E	105_A	0.617	0.59
31_S	79_S	0.617	0.59
14_E	109_I	0.615	0.58
27_C	58_K	0.610	0.58
118_E	141_I	0.606	0.57
48_T	54_L	0.600	0.57
138_P	142_R	0.600	0.57
60_I	124_R	0.593	0.56
55_G	85_G	0.590	0.55
77_K	131_D	0.588	0.55
69_I	84_S	0.588	0.55
30_G	50_K	0.588	0.55
82_H	85_G	0.580	0.54
97_D	142_R	0.579	0.54
51_T	57_E	0.578	0.54
152_D	156_F	0.578	0.54
118_E	122_R	0.575	0.53
79_S	84_S	0.571	0.53
13_G	114_N	0.571	0.53
32_H	35_E	0.570	0.53
6_E	121_E	0.570	0.53
30_G	77_K	0.567	0.52
81_G	113_E	0.567	0.52
22_S	68_N	0.562	0.52
62_N	65_S	0.562	0.52
141_I	145_I	0.559	0.51
70_R	130_V	0.555	0.51
13_G	107_G	0.554	0.51
62_N	69_I	0.553	0.51
5_A	10_P	0.553	0.51
20_P	78_E	0.551	0.50
82_H	110_P	0.549	0.50
29_L	75_C	0.549	0.50
52_E	87_S	0.547	0.50
147_E	150_A	0.546	0.50
98_E	139_E	0.544	0.49
13_G	62_N	0.543	0.49
10_P	81_G	0.543	0.49
17_V	20_P	0.542	0.49
72_L	88_L	0.540	0.49
6_E	96_V	0.537	0.49
42_G	142_R	0.535	0.48
27_C	46_V	0.534	0.48
27_C	105_A	0.533	0.48
12_P	23_P	0.532	0.48
84_S	129_L	0.532	0.48
50_K	113_E	0.530	0.48
149_A	152_D	0.522	0.47
63_V	70_R	0.522	0.47
15_Y	44_A	0.519	0.46
148_L	153_P	0.518	0.46
74_L	80_K	0.518	0.46
74_L	134_G	0.516	0.46
36_K	145_I	0.513	0.46
119_A	122_R	0.512	0.45
49_L	88_L	0.511	0.45
63_V	69_I	0.511	0.45
15_Y	57_E	0.510	0.45
22_S	43_A	0.506	0.45
149_A	153_P	0.506	0.45
90_A	93_E	0.505	0.45
17_V	68_N	0.502	0.44
78_E	108_A	0.502	0.44
50_K	79_S	0.500	0.44

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ghfA	2	0.3064	41.5	0.942	Contact Map
1wteA	2	0.7861	20	0.951	Contact Map
2i32A	1	0.4104	11.3	0.956	Contact Map
2dykA	1	0.4913	7.9	0.959	Contact Map
4ileA	1	0.6069	7.6	0.959	Contact Map
2h9aA	1	0.5491	7.5	0.959	Contact Map
1a9xA	3	0.8728	7.5	0.959	Contact Map
4um9B	2	0.8786	7.3	0.96	Contact Map
1rocA	1	0.4104	6.7	0.96	Contact Map
4f0hB	3	0.3815	6.7	0.96	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.