SCAMP - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SCAMP - SCAMP family

PFAM:	PF04144	Sequences: ENNWPPFFPCFYHDISVEIPEEFQRLVKRAYYLWLGLVLTLFLNLIACLAAFIVGGGGVKFFGLSILYFLLFTPCSFVCWYRPLYKAFRSDSSFNFFVFFFFFFFQIVFCIIQAIGIPGWGLCGWIAAIDLFSGNVAVGIFMLIGAGLFTLEAVLSIWVLKKVHRYYRGT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	170 (169)
Sequences:	710 (422)
Seq/√Len:	32.5
META:	0.197

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
125_W	150_T	4.455	1.00
13_H	81_Y	4.202	1.00
4_W	31_Y	4.062	1.00
14_D	17_V	3.992	1.00
116_G	121_G	3.921	1.00
128_A	146_A	3.836	1.00
30_A	84_L	3.691	1.00
21_E	24_Q	3.356	1.00
137_A	141_F	3.263	1.00
45_L	69_F	3.115	1.00
34_W	76_S	3.113	1.00
132_F	143_L	2.322	0.99
69_F	73_T	2.088	0.98
77_F	81_Y	2.081	0.98
136_V	140_I	2.065	0.98
113_Q	149_F	2.047	0.98
99_F	103_F	1.984	0.98
47_A	145_G	1.924	0.97
93_S	101_F	1.867	0.97
161_K	165_R	1.813	0.96
96_F	100_F	1.786	0.95
114_A	150_T	1.778	0.95
164_H	167_Y	1.774	0.95
125_W	146_A	1.760	0.95
66_I	90_S	1.753	0.95
113_Q	122_L	1.681	0.94
84_L	159_V	1.670	0.94
80_W	106_Q	1.548	0.91
143_L	147_G	1.543	0.90
12_Y	17_V	1.534	0.90
100_F	103_F	1.467	0.88
42_F	69_F	1.462	0.88
49_L	53_I	1.447	0.87
45_L	105_F	1.411	0.86
12_Y	18_E	1.382	0.85
36_G	40_T	1.367	0.84
49_L	62_F	1.356	0.84
45_L	65_S	1.349	0.83
25_R	29_R	1.347	0.83
128_A	132_F	1.340	0.83
156_S	165_R	1.294	0.81
35_L	39_L	1.291	0.80
76_S	83_P	1.252	0.78
67_L	154_V	1.239	0.78
76_S	80_W	1.225	0.77
79_C	102_F	1.216	0.76
47_A	123_C	1.204	0.76
91_D	96_F	1.190	0.75
102_F	112_I	1.190	0.75
135_N	139_G	1.163	0.73
15_I	19_I	1.156	0.72
77_F	85_Y	1.149	0.72
51_A	127_A	1.146	0.72
47_A	141_F	1.137	0.71
54_V	135_N	1.135	0.71
13_H	19_I	1.133	0.71
46_I	50_A	1.133	0.71
15_I	28_K	1.117	0.70
96_F	99_F	1.110	0.69
73_T	77_F	1.105	0.69
152_E	155_L	1.097	0.68
164_H	168_R	1.095	0.68
49_L	52_F	1.094	0.68
131_L	135_N	1.065	0.66
31_Y	34_W	1.054	0.65
83_P	87_A	1.052	0.65
40_T	142_M	1.051	0.65
132_F	135_N	1.049	0.65
71_L	125_W	1.049	0.65
57_G	137_A	1.048	0.65
43_L	119_G	1.038	0.64
26_L	103_F	1.037	0.64
55_G	58_G	1.036	0.64
111_I	115_I	1.036	0.64
41_L	75_C	1.007	0.62
63_G	117_I	1.004	0.61
4_W	129_I	0.999	0.61
103_F	106_Q	0.996	0.61
114_A	146_A	0.994	0.61
63_G	66_I	0.981	0.60
4_W	14_D	0.975	0.59
116_G	122_L	0.971	0.59
115_I	118_P	0.967	0.58
97_F	101_F	0.965	0.58
91_D	102_F	0.949	0.57
54_V	138_V	0.944	0.57
63_G	121_G	0.943	0.57
13_H	31_Y	0.941	0.56
99_F	106_Q	0.936	0.56
33_L	103_F	0.934	0.56
27_V	139_G	0.924	0.55
131_L	139_G	0.924	0.55
9_P	34_W	0.923	0.55
10_C	13_H	0.922	0.55
27_V	88_F	0.912	0.54
30_A	159_V	0.909	0.54
92_S	96_F	0.893	0.52
158_W	162_K	0.892	0.52
91_D	97_F	0.891	0.52
51_A	68_Y	0.887	0.52
42_F	154_V	0.881	0.51
32_Y	46_I	0.879	0.51
7_F	11_F	0.877	0.51
29_R	33_L	0.872	0.51
81_Y	108_V	0.863	0.50
7_F	29_R	0.859	0.50
68_Y	109_F	0.854	0.49
166_Y	169_G	0.845	0.48
20_P	24_Q	0.827	0.47
107_I	156_S	0.826	0.47
64_L	68_Y	0.826	0.47
80_W	83_P	0.825	0.47
87_A	99_F	0.824	0.47
56_G	123_C	0.821	0.47
4_W	35_L	0.817	0.46
50_A	141_F	0.815	0.46
14_D	34_W	0.814	0.46
78_V	150_T	0.806	0.45
111_I	153_A	0.806	0.45
134_G	139_G	0.802	0.45
107_I	110_C	0.802	0.45
47_A	118_P	0.798	0.45
26_L	29_R	0.797	0.45
12_Y	33_L	0.795	0.44
107_I	155_L	0.790	0.44
90_S	104_F	0.790	0.44
72_F	102_F	0.789	0.44
120_W	151_L	0.787	0.44
16_S	24_Q	0.783	0.43
89_R	95_N	0.779	0.43
108_V	137_A	0.776	0.43
108_V	160_L	0.775	0.43
42_F	143_L	0.774	0.43
149_F	155_L	0.773	0.43
138_V	143_L	0.765	0.42
115_I	127_A	0.765	0.42
154_V	158_W	0.762	0.42
2_N	12_Y	0.762	0.42
43_L	145_G	0.756	0.41
53_I	65_S	0.748	0.41
72_F	88_F	0.740	0.40
87_A	103_F	0.738	0.40
12_Y	15_I	0.736	0.40
132_F	139_G	0.736	0.40
91_D	162_K	0.735	0.40
82_R	106_Q	0.733	0.39
94_F	98_V	0.730	0.39
134_G	147_G	0.725	0.39
100_F	106_Q	0.717	0.38
111_I	166_Y	0.716	0.38
81_Y	107_I	0.715	0.38
34_W	83_P	0.710	0.38
46_I	65_S	0.705	0.37
15_I	31_Y	0.703	0.37
89_R	103_F	0.699	0.37
24_Q	159_V	0.698	0.37
93_S	100_F	0.698	0.37
9_P	15_I	0.690	0.36
2_N	8_F	0.687	0.36
77_F	82_R	0.686	0.36
128_A	142_M	0.686	0.36
46_I	98_V	0.681	0.35
81_Y	114_A	0.680	0.35
136_V	139_G	0.676	0.35
67_L	168_R	0.675	0.35
74_P	80_W	0.672	0.35
147_G	151_L	0.671	0.35
46_I	119_G	0.671	0.35
102_F	106_Q	0.670	0.35
109_F	122_L	0.669	0.34
2_N	13_H	0.669	0.34
79_C	109_F	0.668	0.34
133_S	138_V	0.666	0.34
116_G	126_I	0.664	0.34
52_F	149_F	0.661	0.34
18_E	27_V	0.659	0.34
22_E	29_R	0.656	0.34
41_L	83_P	0.655	0.33
18_E	28_K	0.650	0.33
83_P	96_F	0.647	0.33
86_K	95_N	0.632	0.32
43_L	69_F	0.625	0.31
107_I	140_I	0.625	0.31
36_G	101_F	0.624	0.31
93_S	97_F	0.623	0.31
91_D	100_F	0.618	0.31
152_E	158_W	0.614	0.30
133_S	160_L	0.611	0.30
122_L	169_G	0.610	0.30
9_P	83_P	0.606	0.30
107_I	111_I	0.605	0.30
9_P	12_Y	0.603	0.30
137_A	140_I	0.599	0.29
163_V	168_R	0.598	0.29
27_V	32_Y	0.592	0.29
1_E	165_R	0.592	0.29
80_W	100_F	0.590	0.29
88_F	96_F	0.586	0.29
86_K	90_S	0.586	0.29
9_P	31_Y	0.585	0.29
90_S	102_F	0.584	0.28
108_V	111_I	0.576	0.28
39_L	57_G	0.572	0.28
68_Y	75_C	0.571	0.28
48_C	75_C	0.569	0.27
15_I	24_Q	0.566	0.27
148_L	151_L	0.565	0.27
120_W	123_C	0.565	0.27
21_E	29_R	0.564	0.27
7_F	125_W	0.564	0.27
46_I	134_G	0.563	0.27
4_W	144_I	0.561	0.27
86_K	89_R	0.561	0.27
14_D	36_G	0.558	0.27
75_C	125_W	0.558	0.27
37_L	156_S	0.556	0.27
38_V	73_T	0.555	0.27
38_V	140_I	0.553	0.26
61_F	123_C	0.553	0.26
125_W	154_V	0.552	0.26
108_V	140_I	0.550	0.26
70_L	133_S	0.550	0.26
150_T	154_V	0.546	0.26
148_L	155_L	0.542	0.26
95_N	101_F	0.541	0.26
46_I	160_L	0.540	0.26
104_F	108_V	0.540	0.26
41_L	144_I	0.537	0.25
79_C	106_Q	0.537	0.25
17_V	71_L	0.536	0.25
64_L	138_V	0.535	0.25
52_F	126_I	0.534	0.25
50_A	155_L	0.533	0.25
131_L	169_G	0.530	0.25
9_P	100_F	0.526	0.25
120_W	149_F	0.522	0.24
28_K	32_Y	0.521	0.24
127_A	163_V	0.518	0.24
2_N	11_F	0.517	0.24
28_K	119_G	0.513	0.24
46_I	136_V	0.511	0.24
133_S	150_T	0.510	0.24
129_I	132_F	0.509	0.24
114_A	153_A	0.509	0.24
75_C	157_I	0.508	0.24
25_R	132_F	0.507	0.24
44_N	87_A	0.505	0.23
114_A	143_L	0.505	0.23
140_I	144_I	0.504	0.23
66_I	74_P	0.504	0.23
40_T	152_E	0.503	0.23
52_F	55_G	0.502	0.23
62_F	160_L	0.500	0.23
144_I	148_L	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1fftC	1	0.8412	10	0.94	Contact Map
2jlnA	1	0.9353	10	0.94	Contact Map
4bbjA	1	0.8471	5.2	0.948	Contact Map
1m56C	2	0.6647	4.8	0.948	Contact Map
3mktA	1	0.9059	3.7	0.951	Contact Map
4humA	1	0.9118	3.3	0.953	Contact Map
2wmyA	3	0.2941	2.8	0.954	Contact Map
3j08A	2	0.6882	2.7	0.955	Contact Map
3j1zP	8	0.8118	2.4	0.956	Contact Map
1v54C	1	0.9412	2.3	0.956	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.