Vps55 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Vps55 - Vacuolar protein sorting 55

PFAM:	PF04133	Sequences: IIALSFVLAIGFLLVILSCALYNNWWPLLVVLFYVLAPLPNLIFGRCSSDDDSSSSSAWVDLGRFLTGFLVVSGFALPIVLAHAGVIQWGACGMSLAGGLLIYGTILGFFMFFDEEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	117 (115)
Sequences:	525 (346)
Seq/√Len:	32.3
META:	0.284

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_L	21_L	3.261	1.00
19_C	27_P	3.120	1.00
74_G	99_G	3.114	1.00
77_L	80_V	2.927	1.00
26_W	29_L	2.820	1.00
44_F	63_G	2.731	1.00
89_W	93_G	2.457	0.99
1_I	14_L	2.294	0.99
57_S	60_V	2.253	0.99
75_F	100_L	2.244	0.99
11_G	102_I	2.207	0.99
93_G	97_A	2.207	0.99
19_C	87_I	2.150	0.99
20_A	25_W	2.148	0.99
74_G	103_Y	2.126	0.98
79_I	92_C	1.978	0.98
40_P	65_F	1.933	0.97
11_G	98_G	1.683	0.94
82_A	89_W	1.673	0.93
17_L	91_A	1.654	0.93
17_L	40_P	1.631	0.93
4_L	11_G	1.566	0.91
15_V	98_G	1.537	0.90
39_L	80_V	1.514	0.89
36_L	71_V	1.504	0.89
16_I	23_N	1.474	0.88
4_L	21_L	1.331	0.82
25_W	28_L	1.329	0.82
59_W	63_G	1.317	0.82
66_L	88_Q	1.297	0.81
108_G	111_M	1.272	0.79
13_L	17_L	1.269	0.79
60_V	83_H	1.260	0.79
25_W	109_F	1.254	0.78
12_F	70_L	1.245	0.78
33_F	73_S	1.245	0.78
106_I	109_F	1.245	0.78
89_W	96_L	1.235	0.77
3_A	7_V	1.206	0.75
73_S	77_L	1.186	0.74
34_Y	105_T	1.178	0.74
40_P	67_T	1.163	0.73
39_L	43_I	1.126	0.70
96_L	100_L	1.116	0.70
6_F	46_R	1.115	0.69
18_S	94_M	1.095	0.68
57_S	63_G	1.091	0.68
29_L	73_S	1.090	0.68
34_Y	99_G	1.023	0.63
24_N	27_P	1.023	0.63
98_G	102_I	1.019	0.62
38_P	87_I	1.008	0.62
26_W	86_V	0.994	0.60
81_L	91_A	0.992	0.60
81_L	86_V	0.990	0.60
41_N	99_G	0.985	0.60
10_I	72_V	0.975	0.59
10_I	77_L	0.973	0.59
41_N	74_G	0.963	0.58
15_V	33_F	0.953	0.57
104_G	112_F	0.950	0.57
30_V	103_Y	0.938	0.56
15_V	34_Y	0.932	0.55
2_I	81_L	0.926	0.55
104_G	108_G	0.924	0.55
4_L	8_L	0.919	0.54
89_W	92_C	0.911	0.54
14_L	94_M	0.910	0.54
14_L	23_N	0.909	0.54
28_L	31_V	0.907	0.53
24_N	101_L	0.898	0.53
39_L	77_L	0.891	0.52
95_S	99_G	0.872	0.51
55_S	58_A	0.866	0.50
21_L	106_I	0.861	0.50
109_F	114_D	0.853	0.49
11_G	21_L	0.853	0.49
34_Y	40_P	0.848	0.49
91_A	105_T	0.844	0.48
18_S	28_L	0.837	0.48
62_L	68_G	0.818	0.46
17_L	65_F	0.813	0.46
10_I	35_V	0.807	0.45
5_S	8_L	0.805	0.45
71_V	87_I	0.804	0.45
34_Y	67_T	0.801	0.45
49_S	52_D	0.801	0.45
58_A	81_L	0.795	0.44
96_L	111_M	0.795	0.44
26_W	95_S	0.792	0.44
16_I	47_C	0.790	0.44
69_F	76_A	0.789	0.44
4_L	32_L	0.787	0.44
107_L	112_F	0.787	0.44
13_L	18_S	0.784	0.43
28_L	99_G	0.779	0.43
79_I	83_H	0.773	0.42
62_L	71_V	0.759	0.41
32_L	90_G	0.757	0.41
25_W	31_V	0.753	0.41
49_S	87_I	0.749	0.41
35_V	51_D	0.734	0.39
60_V	104_G	0.731	0.39
82_A	105_T	0.729	0.39
8_L	83_H	0.714	0.38
68_G	74_G	0.712	0.38
16_I	20_A	0.711	0.38
38_P	67_T	0.705	0.37
5_S	28_L	0.704	0.37
93_G	115_E	0.699	0.37
32_L	92_C	0.694	0.36
9_A	98_G	0.690	0.36
59_W	70_L	0.689	0.36
18_S	25_W	0.686	0.36
42_L	48_S	0.685	0.36
1_I	5_S	0.683	0.35
111_M	114_D	0.680	0.35
14_L	20_A	0.680	0.35
7_V	101_L	0.669	0.34
9_A	95_S	0.665	0.34
20_A	28_L	0.663	0.34
22_Y	94_M	0.657	0.33
5_S	9_A	0.655	0.33
59_W	92_C	0.654	0.33
16_I	51_D	0.651	0.33
18_S	37_A	0.650	0.33
36_L	69_F	0.629	0.31
96_L	104_G	0.626	0.31
50_D	66_L	0.621	0.31
62_L	66_L	0.616	0.31
27_P	88_Q	0.614	0.30
8_L	12_F	0.612	0.30
30_V	71_V	0.609	0.30
25_W	62_L	0.607	0.30
6_F	10_I	0.601	0.29
63_G	99_G	0.601	0.29
41_N	98_G	0.598	0.29
73_S	101_L	0.596	0.29
82_A	92_C	0.596	0.29
47_C	61_D	0.592	0.29
79_I	115_E	0.592	0.29
32_L	112_F	0.579	0.28
42_L	76_A	0.578	0.28
21_L	86_V	0.573	0.28
6_F	105_T	0.568	0.27
6_F	11_G	0.561	0.27
79_I	98_G	0.561	0.27
1_I	114_D	0.560	0.27
30_V	34_Y	0.556	0.26
30_V	102_I	0.546	0.26
45_G	97_A	0.545	0.26
5_S	12_F	0.544	0.26
24_N	38_P	0.543	0.26
3_A	14_L	0.542	0.26
15_V	73_S	0.537	0.25
81_L	104_G	0.534	0.25
44_F	58_A	0.530	0.25
78_P	106_I	0.529	0.25
75_F	82_A	0.527	0.25
79_I	95_S	0.524	0.24
66_L	114_D	0.522	0.24
35_V	85_G	0.521	0.24
5_S	40_P	0.517	0.24
64_R	75_F	0.514	0.24
3_A	112_F	0.507	0.23
85_G	88_Q	0.507	0.23
8_L	77_L	0.507	0.23
51_D	58_A	0.506	0.23
95_S	106_I	0.506	0.23
12_F	28_L	0.503	0.23
50_D	62_L	0.502	0.23
19_C	63_G	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4j05A	3	0.9402	4	0.928	Contact Map
4oh3A	2	0.9829	4	0.928	Contact Map
2cfqA	1	0.9145	3.7	0.93	Contact Map
4qncA	2	0.7009	3.5	0.93	Contact Map
3o7qA	1	0.8632	3.2	0.932	Contact Map
4pypA	1	0.9231	3.1	0.932	Contact Map
3wdoA	1	0.9145	2.8	0.934	Contact Map
1pw4A	1	0.9402	2.6	0.935	Contact Map
3wqjA	3	0.5897	2.3	0.937	Contact Map
4tq3A	1	0.906	2.2	0.937	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.