zf-like - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

zf-like - Cysteine-rich small domain

PFAM:	PF04071	Sequences: HYKFFQNKECEYFPCHKGEDENCLFCYCPLYPLGDECGGNFVYTENGKVKDCSDCTLPHRPENYDYIIEKLKEILEELKKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	81 (75)
Sequences:	2121 (1561)
Seq/√Len:	180.3
META:	0.873

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
3_K	65_D	3.734	1.00
57_L	66_Y	3.633	1.00
42_V	54_D	3.385	1.00
60_R	63_N	2.400	1.00
71_L	74_I	2.350	1.00
57_L	63_N	2.300	1.00
70_K	73_E	2.233	1.00
71_L	75_L	2.215	1.00
32_P	77_E	2.134	1.00
6_Q	13_F	1.987	1.00
56_T	60_R	1.942	1.00
63_N	66_Y	1.795	1.00
40_N	54_D	1.779	1.00
19_E	56_T	1.757	1.00
38_G	70_K	1.690	1.00
64_Y	68_I	1.496	1.00
32_P	74_I	1.482	1.00
13_F	21_E	1.349	1.00
18_G	56_T	1.325	1.00
57_L	60_R	1.324	1.00
3_K	61_P	1.290	1.00
73_E	76_E	1.276	1.00
17_K	21_E	1.266	1.00
27_Y	68_I	1.241	1.00
42_V	51_D	1.236	1.00
42_V	45_E	1.234	1.00
58_P	67_I	1.129	1.00
38_G	41_F	1.109	1.00
61_P	64_Y	1.077	1.00
36_E	77_E	1.065	1.00
23_C	28_C	1.059	1.00
66_Y	69_E	1.050	1.00
33_L	74_I	1.045	1.00
37_C	50_K	1.015	0.99
32_P	71_L	0.997	0.99
5_F	27_Y	0.987	0.99
7_N	11_E	0.964	0.99
19_E	60_R	0.943	0.99
72_K	75_L	0.937	0.99
31_Y	49_V	0.929	0.99
57_L	67_I	0.918	0.99
35_D	77_E	0.918	0.99
8_K	21_E	0.902	0.99
30_L	58_P	0.900	0.99
18_G	21_E	0.889	0.99
44_T	47_G	0.888	0.99
52_C	55_C	0.861	0.98
30_L	38_G	0.851	0.98
55_C	59_H	0.850	0.98
71_L	77_E	0.842	0.98
30_L	50_K	0.839	0.98
5_F	9_E	0.837	0.98
23_C	26_C	0.825	0.98
6_Q	22_N	0.823	0.98
35_D	43_Y	0.789	0.97
74_I	77_E	0.787	0.97
58_P	63_N	0.774	0.97
34_G	41_F	0.745	0.96
22_N	37_C	0.740	0.95
24_L	68_I	0.737	0.95
17_K	54_D	0.735	0.95
37_C	41_F	0.734	0.95
30_L	67_I	0.722	0.95
62_E	65_D	0.705	0.94
24_L	64_Y	0.696	0.94
4_F	18_G	0.692	0.94
46_N	49_V	0.689	0.93
17_K	56_T	0.688	0.93
25_F	37_C	0.685	0.93
43_Y	46_N	0.681	0.93
25_F	64_Y	0.679	0.93
49_V	71_L	0.677	0.93
25_F	29_P	0.668	0.92
2_Y	11_E	0.664	0.92
9_E	72_K	0.661	0.92
27_Y	31_Y	0.658	0.92
22_N	61_P	0.657	0.92
34_G	77_E	0.645	0.91
25_F	68_I	0.637	0.90
64_Y	67_I	0.616	0.89
30_L	70_K	0.612	0.89
69_E	73_E	0.605	0.88
66_Y	70_K	0.604	0.88
5_F	24_L	0.602	0.88
33_L	70_K	0.592	0.87
11_E	47_G	0.590	0.87
17_K	20_D	0.589	0.87
40_N	51_D	0.577	0.86
38_G	58_P	0.568	0.85
52_C	59_H	0.567	0.85
6_Q	18_G	0.567	0.85
20_D	61_P	0.564	0.84
51_D	54_D	0.556	0.83
15_C	26_C	0.552	0.83
69_E	75_L	0.547	0.82
24_L	50_K	0.540	0.82
35_D	39_G	0.537	0.81
34_G	38_G	0.534	0.81
65_D	76_E	0.530	0.80
53_S	56_T	0.529	0.80
40_N	56_T	0.528	0.80
67_I	70_K	0.527	0.80
27_Y	51_D	0.527	0.80
2_Y	12_Y	0.518	0.79
23_C	31_Y	0.517	0.79
42_V	53_S	0.517	0.79
34_G	37_C	0.515	0.79
65_D	75_L	0.514	0.78
22_N	64_Y	0.509	0.78
72_K	77_E	0.505	0.77
28_C	31_Y	0.502	0.77
65_D	68_I	0.500	0.77

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1co4A	1	0.4444	9.5	0.914	Contact Map
3zj1A	1	0.8025	6.4	0.921	Contact Map
2ebrA	1	0.5309	5.8	0.922	Contact Map
2ebqA	1	0.5309	5.2	0.924	Contact Map
2hgoA	1	0.3333	5.1	0.924	Contact Map
2mjgA	2	0.5679	5	0.925	Contact Map
2d9gA	1	0.5309	5	0.925	Contact Map
2j7aC	2	0.7284	4.7	0.926	Contact Map
3gj5B	1	0.321	4	0.928	Contact Map
2c2xA	2	0.3457	3.8	0.929	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.