MnhB - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MnhB - Domain related to MnhB subunit of Na+/H+ antiporter

PFAM:	PF04039	Sequences: ILRTVARLLLPLILLFGLYVLLHGHNSPGGGFQGGVILAAAFILLYLAFGLEAARRVLPVRLLPRLLEGLGLLLAAGTGLAGLLLGFLTYAFLPLGLLLGELHLGTILLFDLGVGLTVAGALLT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	124 (121)
Sequences:	16829 (10420)
Seq/√Len:	947.3
META:	0.841

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_G	115_G	3.012	1.00
17_G	38_L	2.885	1.00
58_L	61_R	2.874	1.00
54_A	58_L	2.819	1.00
21_L	34_G	2.676	1.00
21_L	115_G	2.434	1.00
79_G	87_F	2.357	1.00
38_L	115_G	2.300	1.00
104_L	108_L	2.285	1.00
20_V	37_I	2.248	1.00
94_P	101_E	2.209	1.00
74_L	113_G	1.994	1.00
96_G	101_E	1.788	1.00
73_L	77_G	1.769	1.00
38_L	119_A	1.766	1.00
81_A	85_L	1.689	1.00
71_G	113_G	1.670	1.00
104_L	107_I	1.655	1.00
14_L	41_A	1.645	1.00
67_L	120_G	1.645	1.00
6_A	48_A	1.643	1.00
13_I	41_A	1.590	1.00
77_G	81_A	1.587	1.00
106_T	110_F	1.542	1.00
78_T	109_L	1.538	1.00
21_L	112_L	1.503	1.00
72_L	117_T	1.496	1.00
105_G	108_L	1.478	1.00
68_E	117_T	1.471	1.00
100_G	103_H	1.466	1.00
23_H	27_S	1.454	1.00
54_A	57_V	1.429	1.00
3_R	49_F	1.415	1.00
61_R	65_R	1.347	1.00
94_P	103_H	1.332	1.00
42_F	123_L	1.310	1.00
94_P	97_L	1.294	1.00
36_V	122_L	1.291	1.00
92_F	103_H	1.283	1.00
79_G	82_G	1.278	1.00
16_F	19_Y	1.251	1.00
56_R	61_R	1.220	1.00
8_L	11_P	1.219	1.00
33_Q	36_V	1.217	1.00
79_G	88_L	1.203	1.00
14_L	38_L	1.172	1.00
105_G	109_L	1.171	1.00
70_L	74_L	1.158	1.00
10_L	45_L	1.138	1.00
10_L	41_A	1.123	1.00
53_A	56_R	1.123	1.00
111_D	117_T	1.092	1.00
4_T	7_R	1.065	1.00
117_T	121_A	1.060	1.00
69_G	73_L	1.057	1.00
3_R	7_R	1.038	1.00
75_A	79_G	1.032	1.00
39_A	122_L	1.013	1.00
91_A	94_P	0.987	1.00
39_A	121_A	0.983	1.00
45_L	53_A	0.979	1.00
51_L	55_R	0.977	1.00
61_R	66_L	0.974	1.00
50_G	53_A	0.963	1.00
91_A	95_L	0.960	1.00
66_L	70_L	0.958	1.00
75_A	110_F	0.957	1.00
45_L	49_F	0.929	1.00
46_Y	51_L	0.926	1.00
10_L	13_I	0.925	1.00
11_P	15_L	0.921	1.00
67_L	116_L	0.921	1.00
31_G	35_G	0.911	1.00
25_H	107_I	0.909	1.00
80_L	83_L	0.894	1.00
13_I	16_F	0.892	1.00
5_V	9_L	0.884	1.00
7_R	49_F	0.881	1.00
105_G	111_D	0.879	1.00
68_E	121_A	0.873	1.00
95_L	100_G	0.871	1.00
107_I	111_D	0.866	1.00
88_L	110_F	0.860	1.00
119_A	122_L	0.859	1.00
75_A	88_L	0.856	1.00
70_L	116_L	0.848	1.00
1_I	4_T	0.835	1.00
16_F	20_V	0.827	1.00
17_G	34_G	0.822	1.00
106_T	109_L	0.814	1.00
54_A	59_P	0.810	1.00
95_L	98_L	0.809	1.00
66_L	69_G	0.809	1.00
117_T	120_G	0.802	1.00
21_L	38_L	0.801	1.00
77_G	82_G	0.801	1.00
18_L	22_L	0.800	1.00
114_V	117_T	0.800	1.00
7_R	11_P	0.795	1.00
2_L	6_A	0.789	1.00
6_A	41_A	0.787	1.00
19_Y	23_H	0.787	1.00
82_G	85_L	0.785	1.00
6_A	44_L	0.777	1.00
57_V	60_V	0.771	1.00
87_F	90_Y	0.771	1.00
2_L	48_A	0.770	1.00
39_A	123_L	0.765	1.00
25_H	31_G	0.765	1.00
45_L	48_A	0.753	1.00
108_L	111_D	0.748	1.00
55_R	58_L	0.746	1.00
9_L	13_I	0.737	1.00
119_A	123_L	0.732	1.00
98_L	101_E	0.730	1.00
86_G	89_T	0.729	1.00
75_A	78_T	0.727	1.00
98_L	103_H	0.721	1.00
74_L	78_T	0.714	1.00
55_R	60_V	0.711	1.00
56_R	60_V	0.701	1.00
23_H	36_V	0.699	1.00
45_L	54_A	0.695	1.00
10_L	14_L	0.691	1.00
82_G	89_T	0.679	1.00
97_L	100_G	0.678	1.00
107_I	110_F	0.677	1.00
4_T	8_L	0.676	1.00
99_L	102_L	0.672	1.00
14_L	17_G	0.668	1.00
81_A	91_A	0.665	1.00
26_N	103_H	0.662	1.00
96_G	103_H	0.655	1.00
52_E	56_R	0.652	1.00
83_L	87_F	0.646	1.00
78_T	81_A	0.645	1.00
72_L	75_A	0.643	1.00
92_F	105_G	0.642	1.00
49_F	52_E	0.636	1.00
76_A	87_F	0.636	1.00
41_A	45_L	0.635	1.00
97_L	101_E	0.634	1.00
54_A	61_R	0.632	1.00
90_Y	107_I	0.629	1.00
81_A	84_L	0.626	1.00
59_P	62_L	0.625	1.00
53_A	57_V	0.614	1.00
78_T	108_L	0.608	1.00
36_V	50_G	0.606	1.00
18_L	21_L	0.601	1.00
42_F	119_A	0.600	1.00
95_L	103_H	0.595	1.00
56_R	59_P	0.593	1.00
110_F	114_V	0.589	1.00
33_Q	40_A	0.583	1.00
9_L	12_L	0.582	1.00
82_G	86_G	0.580	1.00
6_A	10_L	0.579	1.00
112_L	116_L	0.578	1.00
110_F	113_G	0.572	1.00
80_L	84_L	0.572	1.00
72_L	76_A	0.569	1.00
55_R	59_P	0.568	1.00
79_G	110_F	0.568	1.00
71_G	74_L	0.567	1.00
55_R	61_R	0.563	1.00
88_L	91_A	0.556	1.00
97_L	102_L	0.549	1.00
76_A	82_G	0.547	1.00
71_G	120_G	0.544	1.00
111_D	114_V	0.540	1.00
19_Y	37_I	0.538	1.00
12_L	16_F	0.535	1.00
68_E	82_G	0.523	1.00
95_L	99_L	0.520	1.00
71_G	79_G	0.519	1.00
51_L	54_A	0.515	1.00
115_G	119_A	0.511	1.00
93_L	104_L	0.505	1.00
40_A	43_I	0.504	1.00
69_G	72_L	0.502	1.00
46_Y	50_G	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4i0uA	4	0.4113	3.8	0.919	Contact Map
4ev6A	3	0.4274	3.5	0.921	Contact Map
2ks1B	1	0.2984	1.9	0.931	Contact Map
2a65A	2	0.4597	1.7	0.932	Contact Map
4us3A	1	0.8387	1.6	0.933	Contact Map
2jlnA	1	0.9919	1.5	0.934	Contact Map
3qbgA	3	0.2339	1.4	0.936	Contact Map
3pjzA	2	0.8226	1.3	0.937	Contact Map
1xioA	2	0.1855	1.1	0.94	Contact Map
2k1aA	1	0.3387	1.1	0.94	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.