Utp12 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Utp12 - Dip2/Utp12 Family

PFAM:	PF04003	Sequences: DEALLLRVLESIPPSDIELTLLRLPFSYVLRLLRFLAERLESPSHLELLLRWLKFLLKTHGGYLVSNLPLLPVLRSLQKALRRRLKELKDLLGLNGARLDYLLS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	104 (101)
Sequences:	1994 (1435)
Seq/√Len:	142.8
META:	0.337

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
25_P	28_Y	3.750	1.00
9_L	49_L	3.594	1.00
10_E	45_H	3.061	1.00
53_L	77_L	2.668	1.00
37_A	80_A	2.259	1.00
6_L	39_R	2.216	1.00
96_G	101_Y	2.205	1.00
7_R	11_S	2.159	1.00
28_Y	31_R	2.143	1.00
41_E	76_S	1.995	1.00
13_P	16_D	1.916	1.00
21_L	56_L	1.870	1.00
8_V	11_S	1.832	1.00
55_F	59_T	1.732	1.00
26_F	63_Y	1.710	1.00
24_L	29_V	1.683	1.00
37_A	76_S	1.617	1.00
5_L	35_F	1.576	1.00
61_G	65_V	1.537	1.00
78_Q	82_R	1.503	1.00
16_D	19_L	1.496	1.00
94_L	98_R	1.488	1.00
98_R	101_Y	1.446	1.00
47_E	51_R	1.434	1.00
2_E	38_E	1.402	1.00
98_R	102_L	1.373	1.00
62_G	66_S	1.362	1.00
21_L	59_T	1.329	1.00
86_K	90_D	1.320	1.00
18_E	55_F	1.295	1.00
63_Y	67_N	1.275	1.00
20_T	84_R	1.267	1.00
45_H	48_L	1.264	1.00
35_F	39_R	1.263	1.00
37_A	53_L	1.257	1.00
29_V	70_L	1.252	1.00
72_P	81_L	1.213	1.00
16_D	47_E	1.187	1.00
40_L	84_R	1.185	1.00
73_V	83_R	1.159	1.00
2_E	12_I	1.156	0.99
36_L	53_L	1.145	0.99
10_E	48_L	1.110	0.99
22_L	59_T	1.104	0.99
83_R	87_E	1.099	0.99
64_L	67_N	1.098	0.99
21_L	55_F	1.077	0.99
57_L	84_R	1.044	0.99
95_N	98_R	1.035	0.99
17_I	52_W	1.015	0.99
4_L	8_V	1.004	0.99
45_H	52_W	1.004	0.99
46_L	84_R	0.994	0.98
91_L	98_R	0.992	0.98
40_L	53_L	0.987	0.98
93_G	98_R	0.984	0.98
18_E	51_R	0.971	0.98
6_L	45_H	0.971	0.98
89_K	93_G	0.935	0.98
5_L	14_P	0.912	0.97
14_P	18_E	0.910	0.97
57_L	91_L	0.906	0.97
80_A	88_L	0.896	0.97
9_L	101_Y	0.895	0.97
13_P	79_K	0.887	0.97
12_I	15_S	0.880	0.97
6_L	17_I	0.868	0.96
3_A	7_R	0.866	0.96
31_R	35_F	0.858	0.96
64_L	74_L	0.854	0.96
7_R	10_E	0.852	0.96
53_L	102_L	0.843	0.96
46_L	95_N	0.835	0.96
10_E	72_P	0.834	0.95
5_L	8_V	0.817	0.95
26_F	60_H	0.812	0.95
90_D	99_L	0.812	0.95
47_E	102_L	0.802	0.94
26_F	67_N	0.793	0.94
48_L	95_N	0.792	0.94
47_E	95_N	0.792	0.94
4_L	17_I	0.789	0.94
11_S	81_L	0.785	0.94
83_R	99_L	0.784	0.94
6_L	10_E	0.777	0.93
22_L	55_F	0.775	0.93
85_L	98_R	0.769	0.93
44_S	66_S	0.768	0.93
22_L	100_D	0.767	0.93
43_P	87_E	0.751	0.92
27_S	58_K	0.751	0.92
15_S	22_L	0.749	0.92
18_E	58_K	0.740	0.92
37_A	61_G	0.721	0.91
85_L	88_L	0.719	0.91
34_R	80_A	0.710	0.90
38_E	69_P	0.703	0.90
2_E	11_S	0.700	0.89
8_V	69_P	0.699	0.89
12_I	47_E	0.696	0.89
29_V	56_L	0.690	0.89
35_F	62_G	0.685	0.88
55_F	58_K	0.684	0.88
23_R	29_V	0.679	0.88
5_L	39_R	0.678	0.88
43_P	49_L	0.673	0.87
13_P	20_T	0.645	0.85
8_V	12_I	0.644	0.85
48_L	65_V	0.642	0.85
32_L	96_G	0.640	0.85
73_V	76_S	0.637	0.84
59_T	63_Y	0.637	0.84
42_S	78_Q	0.629	0.84
11_S	15_S	0.622	0.83
37_A	88_L	0.620	0.83
40_L	50_L	0.608	0.82
2_E	83_R	0.607	0.81
24_L	32_L	0.605	0.81
22_L	99_L	0.602	0.81
80_A	84_R	0.600	0.81
3_A	16_D	0.588	0.79
61_G	81_L	0.586	0.79
96_G	100_D	0.585	0.79
77_L	80_A	0.585	0.79
22_L	36_L	0.584	0.79
92_L	97_A	0.575	0.78
86_K	96_G	0.572	0.77
17_I	31_R	0.565	0.77
45_H	49_L	0.563	0.76
27_S	76_S	0.559	0.76
29_V	60_H	0.557	0.76
41_E	44_S	0.553	0.75
28_Y	102_L	0.549	0.75
64_L	69_P	0.548	0.74
90_D	93_G	0.543	0.74
96_G	99_L	0.542	0.74
36_L	49_L	0.542	0.74
37_A	41_E	0.529	0.72
84_R	91_L	0.528	0.72
94_L	99_L	0.527	0.72
41_E	50_L	0.526	0.71
63_Y	70_L	0.518	0.70
10_E	49_L	0.517	0.70
75_R	82_R	0.517	0.70
12_I	84_R	0.511	0.69
8_V	54_K	0.506	0.69
52_W	61_G	0.503	0.68
89_K	95_N	0.502	0.68
25_P	31_R	0.502	0.68
31_R	34_R	0.501	0.68
4_L	7_R	0.500	0.68
71_L	75_R	0.500	0.68

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1vu2F	1	0.9615	73.1	0.787	Contact Map
3s6n2	1	0.9135	70.3	0.791	Contact Map
3dwlG	1	0.6731	51.8	0.814	Contact Map
4bzjA	2	0.9904	46.4	0.82	Contact Map
1k8kG	1	0.7404	42.8	0.824	Contact Map
4rh7A	1	0.9423	14.1	0.861	Contact Map
3re2A	1	0.9423	10.1	0.869	Contact Map
2vxgA	1	0.9231	9.8	0.87	Contact Map
3wuqA	1	0.9615	9.3	0.872	Contact Map
1ybkA	3	0.4038	8.7	0.874	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.