Cgr1 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Cgr1 - Cgr1 family

PFAM:	PF03879	Sequences: KGKRKSGRVWKAPKKAFRSSSGKVKKKGLKTSWEKRMEERAEKKAVKELEKELKEEKEAERQRKRERRKERRKRKEENERKEEMAQKMNAKKVKRMKKKEKRNKLLKE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	108 (105)
Sequences:	521 (366)
Seq/√Len:	35.7
META:	0.253

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
51_K	55_E	3.109	1.00
55_E	59_A	3.024	1.00
66_E	70_E	2.743	1.00
68_R	72_R	2.642	1.00
37_M	40_R	2.530	1.00
33_W	36_R	2.310	0.99
61_R	65_R	2.279	0.99
38_E	41_A	2.272	0.99
65_R	69_K	2.102	0.99
76_E	79_E	1.965	0.98
1_K	13_P	1.938	0.98
41_A	45_A	1.920	0.98
63_R	67_R	1.888	0.98
32_S	35_K	1.810	0.97
62_Q	66_E	1.797	0.97
43_K	47_K	1.775	0.96
58_E	62_Q	1.759	0.96
67_R	71_R	1.693	0.95
89_N	93_V	1.679	0.95
70_E	74_R	1.677	0.95
41_A	44_K	1.659	0.95
38_E	42_E	1.645	0.95
52_E	56_E	1.590	0.93
92_K	96_M	1.553	0.93
59_A	63_R	1.541	0.92
80_R	83_E	1.529	0.92
60_E	63_R	1.497	0.91
18_R	21_S	1.451	0.90
101_K	105_L	1.421	0.89
97_K	102_R	1.419	0.89
78_N	81_K	1.381	0.87
75_K	79_E	1.350	0.86
56_E	59_A	1.336	0.86
46_V	50_E	1.312	0.85
72_R	76_E	1.287	0.83
19_S	22_G	1.244	0.81
19_S	24_V	1.130	0.74
6_S	10_W	1.117	0.74
35_K	59_A	1.114	0.73
69_K	73_K	1.094	0.72
81_K	85_A	1.092	0.72
4_R	8_R	1.068	0.70
65_R	68_R	1.064	0.70
31_T	39_E	1.056	0.69
26_K	72_R	1.034	0.68
64_K	72_R	1.030	0.67
2_G	5_K	1.020	0.67
67_R	75_K	1.001	0.65
62_Q	65_R	1.001	0.65
18_R	25_K	0.998	0.65
53_L	56_E	0.988	0.64
99_K	105_L	0.971	0.63
35_K	38_E	0.958	0.62
7_G	10_W	0.953	0.61
94_K	98_K	0.945	0.61
63_R	66_E	0.937	0.60
55_E	58_E	0.935	0.60
78_N	82_E	0.927	0.59
3_K	6_S	0.923	0.59
81_K	88_M	0.920	0.58
78_N	88_M	0.918	0.58
17_F	21_S	0.913	0.58
50_E	54_K	0.909	0.58
47_K	54_K	0.906	0.57
81_K	84_M	0.896	0.56
20_S	23_K	0.895	0.56
59_A	62_Q	0.892	0.56
95_R	102_R	0.882	0.55
6_S	11_K	0.879	0.55
24_V	56_E	0.873	0.54
82_E	85_A	0.862	0.54
44_K	48_E	0.855	0.53
100_E	104_K	0.853	0.53
66_E	73_K	0.851	0.53
70_E	73_K	0.849	0.52
101_K	104_K	0.848	0.52
94_K	101_K	0.847	0.52
99_K	102_R	0.844	0.52
19_S	23_K	0.834	0.51
74_R	78_N	0.827	0.50
47_K	53_L	0.823	0.50
68_R	71_R	0.821	0.50
83_E	86_Q	0.791	0.47
31_T	36_R	0.781	0.47
51_K	62_Q	0.780	0.46
26_K	68_R	0.780	0.46
84_M	88_M	0.770	0.46
8_R	11_K	0.766	0.45
34_E	38_E	0.759	0.45
77_E	80_R	0.754	0.44
39_E	42_E	0.751	0.44
92_K	100_E	0.750	0.44
11_K	96_M	0.744	0.43
97_K	101_K	0.743	0.43
17_F	20_S	0.736	0.43
94_K	100_E	0.734	0.43
46_V	49_L	0.733	0.42
86_Q	94_K	0.722	0.41
89_N	92_K	0.719	0.41
48_E	90_A	0.716	0.41
88_M	94_K	0.714	0.41
66_E	69_K	0.710	0.40
78_N	105_L	0.709	0.40
2_G	40_R	0.703	0.40
78_N	99_K	0.686	0.38
60_E	64_K	0.678	0.38
45_A	71_R	0.657	0.36
90_A	93_V	0.656	0.36
49_L	52_E	0.653	0.36
44_K	51_K	0.653	0.36
80_R	95_R	0.652	0.36
96_M	100_E	0.650	0.36
34_E	51_K	0.643	0.35
28_G	33_W	0.642	0.35
88_M	95_R	0.636	0.34
41_A	55_E	0.636	0.34
14_K	95_R	0.635	0.34
15_K	22_G	0.633	0.34
86_Q	90_A	0.633	0.34
38_E	44_K	0.632	0.34
37_M	41_A	0.630	0.34
42_E	46_V	0.629	0.34
89_N	95_R	0.624	0.34
100_E	103_N	0.618	0.33
85_A	91_K	0.617	0.33
14_K	17_F	0.617	0.33
90_A	94_K	0.613	0.33
8_R	78_N	0.613	0.33
73_K	79_E	0.613	0.33
97_K	100_E	0.612	0.33
20_S	24_V	0.610	0.32
15_K	57_K	0.609	0.32
50_E	71_R	0.608	0.32
16_A	20_S	0.607	0.32
45_A	52_E	0.599	0.32
6_S	33_W	0.595	0.31
22_G	25_K	0.583	0.30
96_M	101_K	0.580	0.30
2_G	6_S	0.579	0.30
78_N	86_Q	0.570	0.30
76_E	80_R	0.569	0.29
40_R	93_V	0.567	0.29
85_A	104_K	0.559	0.29
54_K	58_E	0.559	0.29
24_V	50_E	0.559	0.29
14_K	102_R	0.558	0.29
93_V	101_K	0.552	0.28
94_K	105_L	0.541	0.27
81_K	86_Q	0.540	0.27
71_R	74_R	0.538	0.27
11_K	19_S	0.531	0.27
26_K	29_L	0.529	0.27
33_W	69_K	0.516	0.26
95_R	100_E	0.512	0.26
35_K	39_E	0.511	0.25
2_G	75_K	0.508	0.25
50_E	98_K	0.508	0.25
12_A	53_L	0.500	0.25

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3suiB	1	0.1111	18.2	0.892	Contact Map
3f1iH	1	0.6759	1.4	0.937	Contact Map
3vogA	1	0.25	1.1	0.942	Contact Map
3sdeA	1	0.6852	0.9	0.945	Contact Map
4uera	1	0	0.8	0.946	Contact Map
1vw48	1	0.5926	0.8	0.947	Contact Map
3j7yY	1	0.6667	0.8	0.948	Contact Map
3hzpA	2	0.3148	0.7	0.949	Contact Map
1eyoA	1	0.0926	0.7	0.949	Contact Map
4cpyA	2	0.2963	0.7	0.95	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.