Glyco_tran_WecB - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Glyco_tran_WecB - Glycosyl transferase WecB/TagA/CpsF family

PFAM:	PF03808	Sequences: ILNSADLVLPDGMPLVWAARLLGGKPLPERVAGPDLMPALLERAAERGLRVFLLGGTPGVAEKAAERLRERYPGLRIAGTYSPPFRTPEEEEEIIERINASGPDILFVGLGAPKQEKWIARHRDRLNVPVAIGVGAAFDFLAGRVKRAPRWMQRLGLEWLYRLLQEPRRLWRR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	173 (171)
Sequences:	34075 (26691)
Seq/√Len:	2041.1
META:	0.893

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
50_R	104_D	3.056	1.00
52_F	79_G	2.934	1.00
81_Y	97_R	2.720	1.00
119_I	131_A	2.637	1.00
63_K	144_R	2.616	1.00
65_A	69_R	2.508	1.00
119_I	133_G	2.476	1.00
99_N	127_N	2.330	1.00
96_E	100_A	2.221	1.00
50_R	76_R	2.097	1.00
32_A	147_R	2.047	1.00
118_W	122_H	2.041	1.00
52_F	97_R	2.012	1.00
67_R	70_E	2.001	1.00
67_R	71_R	1.994	1.00
150_R	154_R	1.959	1.00
4_S	120_A	1.933	1.00
58_P	82_S	1.917	1.00
39_A	42_E	1.902	1.00
58_P	62_E	1.850	1.00
45_A	74_G	1.840	1.00
51_V	107_F	1.824	1.00
65_A	80_T	1.788	1.00
49_L	104_D	1.712	1.00
63_K	66_E	1.682	1.00
104_D	129_P	1.635	1.00
38_P	71_R	1.630	1.00
44_A	51_V	1.555	1.00
145_V	166_E	1.552	1.00
61_A	80_T	1.539	1.00
136_A	140_F	1.531	1.00
151_W	155_L	1.491	1.00
63_K	67_R	1.482	1.00
44_A	49_L	1.461	1.00
43_R	47_R	1.391	1.00
150_R	153_Q	1.389	1.00
81_Y	84_P	1.375	1.00
108_V	119_I	1.339	1.00
106_L	128_V	1.337	1.00
37_M	141_L	1.335	1.00
117_K	120_A	1.325	1.00
50_R	78_A	1.322	1.00
57_T	144_R	1.321	1.00
37_M	137_A	1.312	1.00
170_L	173_R	1.307	1.00
161_Y	165_Q	1.302	1.00
34_P	137_A	1.290	1.00
91_E	121_R	1.267	1.00
106_L	131_A	1.255	1.00
92_E	125_R	1.252	1.00
19_A	28_P	1.250	1.00
152_M	157_L	1.244	1.00
54_L	94_I	1.222	1.00
61_A	65_A	1.220	1.00
122_H	125_R	1.218	1.00
13_M	16_V	1.213	1.00
34_P	140_F	1.199	1.00
52_F	81_Y	1.197	1.00
152_M	155_L	1.193	1.00
160_L	164_L	1.192	1.00
123_R	131_A	1.189	1.00
43_R	46_E	1.189	1.00
62_E	66_E	1.171	1.00
95_I	125_R	1.167	1.00
88_P	91_E	1.165	1.00
5_A	8_V	1.160	1.00
13_M	30_R	1.159	1.00
78_A	101_S	1.158	1.00
90_E	93_E	1.150	1.00
41_L	51_V	1.142	1.00
53_L	138_F	1.134	1.00
66_E	70_E	1.128	1.00
95_I	99_N	1.116	1.00
6_D	123_R	1.112	1.00
147_R	158_E	1.109	1.00
97_R	101_S	1.101	1.00
48_G	76_R	1.098	1.00
163_L	171_W	1.097	1.00
37_M	107_F	1.094	1.00
111_G	115_Q	1.094	1.00
97_R	100_A	1.091	1.00
50_R	101_S	1.091	1.00
109_G	134_V	1.089	1.00
41_L	68_L	1.084	1.00
56_G	61_A	1.084	1.00
18_A	22_L	1.083	1.00
145_V	165_Q	1.077	1.00
38_P	72_Y	1.077	1.00
38_P	141_L	1.072	1.00
146_K	165_Q	1.065	1.00
35_D	147_R	1.062	1.00
92_E	96_E	1.055	1.00
147_R	153_Q	1.043	1.00
42_E	45_A	1.029	1.00
42_E	72_Y	1.028	1.00
14_P	18_A	1.023	1.00
139_D	144_R	1.021	1.00
81_Y	94_I	1.019	1.00
52_F	103_P	1.000	1.00
86_R	90_E	0.999	1.00
66_E	69_R	0.999	1.00
87_T	90_E	0.997	1.00
96_E	99_N	0.995	1.00
14_P	17_W	0.979	1.00
117_K	121_R	0.977	1.00
39_A	43_R	0.963	1.00
91_E	122_H	0.960	1.00
109_G	138_F	0.950	1.00
148_A	153_Q	0.949	1.00
43_R	49_L	0.947	1.00
157_L	160_L	0.945	1.00
13_M	17_W	0.939	1.00
139_D	145_V	0.939	1.00
64_A	138_F	0.934	1.00
149_P	161_Y	0.931	1.00
99_N	125_R	0.931	1.00
19_A	25_K	0.926	1.00
168_R	171_W	0.924	1.00
148_A	158_E	0.923	1.00
60_V	144_R	0.923	1.00
102_G	127_N	0.922	1.00
40_L	105_I	0.917	1.00
87_T	91_E	0.914	1.00
95_I	122_H	0.914	1.00
115_Q	133_G	0.890	1.00
148_A	161_Y	0.881	1.00
91_E	118_W	0.871	1.00
67_R	141_L	0.865	1.00
81_Y	85_F	0.859	1.00
56_G	60_V	0.859	1.00
42_E	46_E	0.857	1.00
37_M	41_L	0.856	1.00
107_F	134_V	0.856	1.00
56_G	139_D	0.853	1.00
57_T	60_V	0.851	1.00
19_A	27_L	0.850	1.00
153_Q	158_E	0.849	1.00
60_V	139_D	0.846	1.00
30_R	153_Q	0.834	1.00
9_L	36_L	0.832	1.00
49_L	105_I	0.815	1.00
42_E	71_R	0.815	1.00
44_A	105_I	0.809	1.00
93_E	96_E	0.808	1.00
88_P	92_E	0.807	1.00
16_V	20_R	0.806	1.00
38_P	42_E	0.805	1.00
57_T	139_D	0.802	1.00
45_A	75_L	0.799	1.00
32_A	35_D	0.795	1.00
83_P	86_R	0.792	1.00
126_L	131_A	0.787	1.00
17_W	21_L	0.787	1.00
51_V	105_I	0.786	1.00
86_R	89_E	0.783	1.00
16_V	30_R	0.783	1.00
166_E	169_R	0.779	1.00
93_E	97_R	0.768	1.00
64_A	68_L	0.767	1.00
146_K	161_Y	0.763	1.00
20_R	26_P	0.762	1.00
33_G	134_V	0.754	1.00
16_V	27_L	0.734	1.00
106_L	129_P	0.734	1.00
34_P	38_P	0.729	1.00
13_M	156_G	0.727	1.00
50_R	102_G	0.727	1.00
89_E	92_E	0.723	1.00
54_L	110_L	0.723	1.00
128_V	131_A	0.721	1.00
52_F	98_I	0.708	1.00
140_F	145_V	0.708	1.00
89_E	93_E	0.707	1.00
59_G	62_E	0.707	1.00
2_L	8_V	0.704	1.00
41_L	75_L	0.697	1.00
35_D	153_Q	0.696	1.00
33_G	137_A	0.695	1.00
68_L	141_L	0.694	1.00
57_T	61_A	0.685	1.00
152_M	160_L	0.685	1.00
17_W	20_R	0.684	1.00
53_L	68_L	0.683	1.00
67_R	142_A	0.680	1.00
62_E	65_A	0.677	1.00
82_S	85_F	0.673	1.00
61_A	82_S	0.671	1.00
64_A	141_L	0.670	1.00
19_A	23_G	0.663	1.00
160_L	163_L	0.660	1.00
52_F	106_L	0.658	1.00
107_F	138_F	0.658	1.00
62_E	80_T	0.656	1.00
134_V	137_A	0.655	1.00
140_F	147_R	0.650	1.00
88_P	93_E	0.647	1.00
60_V	63_K	0.647	1.00
153_Q	156_G	0.645	1.00
10_P	16_V	0.639	1.00
45_A	72_Y	0.638	1.00
98_I	106_L	0.619	1.00
168_R	173_R	0.611	1.00
3_N	8_V	0.605	1.00
103_P	106_L	0.603	1.00
94_I	97_R	0.600	1.00
91_E	95_I	0.599	1.00
60_V	142_A	0.597	1.00
114_K	117_K	0.597	1.00
113_P	117_K	0.596	1.00
120_A	123_R	0.596	1.00
149_P	152_M	0.588	1.00
140_F	148_A	0.587	1.00
37_M	134_V	0.585	1.00
122_H	126_L	0.584	1.00
34_P	147_R	0.582	1.00
41_L	45_A	0.580	1.00
64_A	67_R	0.579	1.00
10_P	27_L	0.578	1.00
134_V	138_F	0.576	1.00
78_A	103_P	0.575	1.00
87_T	92_E	0.575	1.00
152_M	164_L	0.574	1.00
17_W	156_G	0.571	1.00
71_R	141_L	0.567	1.00
53_L	65_A	0.564	1.00
69_R	76_R	0.563	1.00
63_K	142_A	0.562	1.00
44_A	48_G	0.562	1.00
59_G	63_K	0.557	1.00
68_L	75_L	0.557	1.00
44_A	47_R	0.554	1.00
151_W	154_R	0.551	1.00
84_P	110_L	0.548	1.00
10_P	19_A	0.546	1.00
52_F	101_S	0.545	1.00
79_G	97_R	0.541	1.00
99_N	126_L	0.539	1.00
152_M	161_Y	0.535	1.00
48_G	74_G	0.525	1.00
126_L	129_P	0.524	1.00
30_R	34_P	0.524	1.00
16_V	29_E	0.523	1.00
147_R	161_Y	0.522	1.00
35_D	150_R	0.520	1.00
69_R	74_G	0.519	1.00
59_G	144_R	0.515	1.00
58_P	61_A	0.513	1.00
141_L	145_V	0.510	1.00
142_A	145_V	0.510	1.00
148_A	152_M	0.510	1.00
40_L	107_F	0.508	1.00
83_P	114_K	0.508	1.00
53_L	64_A	0.508	1.00
10_P	14_P	0.506	1.00
88_P	121_R	0.506	1.00
79_G	101_S	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2qsjA	2	0.6301	59	0.91	Contact Map
3cnbA	1	0.6532	58.1	0.911	Contact Map
3g40A	2	0.6821	57.7	0.911	Contact Map
4lzlA	1	0.659	55.6	0.912	Contact Map
1a2oA	1	0.6532	55	0.912	Contact Map
2qv0A	2	0.6763	52.2	0.914	Contact Map
4r3uC	1	0.6705	51.9	0.914	Contact Map
1qkkA	2	0.659	51.6	0.914	Contact Map
4xaqA	2	0.9827	49.7	0.915	Contact Map
4cbvA	2	0.6474	48	0.916	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.