Asp23 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Asp23 - Asp23 family, cell envelope-related function

PFAM:	PF03780	Sequences: LGKITISDEVIATIAGLAALEVYGVVGMAGGLADGLAELLGRKNLSKGVKVEVGEDDEVAIDLYVVVEYGVNIPEVARNVQENVKYAVERMTGLEVAEVNVHVQGVR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	107 (105)
Sequences:	16951 (10615)
Seq/√Len:	1035.9
META:	0.824

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
58_E	97_A	3.188	1.00
60_A	97_A	2.844	1.00
72_N	75_E	2.616	1.00
62_D	100_N	2.504	1.00
64_Y	102_H	2.361	1.00
60_A	98_E	2.272	1.00
64_Y	104_Q	2.241	1.00
66_V	105_G	2.123	1.00
58_E	95_E	2.104	1.00
67_V	76_V	2.021	1.00
21_E	83_N	1.903	1.00
15_A	61_I	1.872	1.00
65_V	80_V	1.867	1.00
83_N	87_A	1.821	1.00
26_V	68_E	1.820	1.00
86_Y	90_R	1.801	1.00
67_V	73_I	1.779	1.00
75_E	78_R	1.777	1.00
89_E	95_E	1.760	1.00
87_A	90_R	1.721	1.00
79_N	83_N	1.659	1.00
63_L	84_V	1.645	1.00
85_K	89_E	1.563	1.00
75_E	79_N	1.529	1.00
19_A	80_V	1.465	1.00
61_I	88_V	1.434	1.00
71_V	76_V	1.426	1.00
54_G	58_E	1.422	1.00
14_I	91_M	1.380	1.00
78_R	81_Q	1.378	1.00
52_E	60_A	1.333	1.00
62_D	102_H	1.318	1.00
73_I	103_V	1.310	1.00
54_G	60_A	1.306	1.00
19_A	63_L	1.297	1.00
8_D	53_V	1.272	1.00
78_R	82_E	1.271	1.00
79_N	82_E	1.241	1.00
21_E	87_A	1.237	1.00
23_Y	71_V	1.205	1.00
53_V	59_V	1.204	1.00
88_V	96_V	1.180	1.00
18_A	87_A	1.164	1.00
68_E	71_V	1.142	1.00
59_V	94_L	1.101	1.00
50_K	62_D	1.065	1.00
25_V	80_V	1.062	1.00
74_P	78_R	1.057	1.00
17_L	20_L	1.055	1.00
81_Q	85_K	1.039	1.00
16_G	20_L	1.030	1.00
29_A	66_V	1.025	1.00
83_N	86_Y	1.023	1.00
14_I	92_T	1.004	1.00
82_E	86_Y	0.986	1.00
87_A	91_M	0.969	1.00
22_V	80_V	0.950	1.00
51_V	61_I	0.945	1.00
27_G	66_V	0.937	1.00
23_Y	79_N	0.932	1.00
96_V	99_V	0.927	1.00
7_S	10_V	0.927	1.00
54_G	97_A	0.927	1.00
81_Q	100_N	0.918	1.00
85_K	99_V	0.908	1.00
77_A	103_V	0.907	1.00
23_Y	68_E	0.905	1.00
17_L	21_E	0.905	1.00
5_T	8_D	0.903	1.00
1_L	4_I	0.900	1.00
22_V	83_N	0.881	1.00
28_M	48_G	0.878	1.00
6_I	10_V	0.856	1.00
80_V	84_V	0.852	1.00
60_A	100_N	0.843	1.00
11_I	92_T	0.840	1.00
35_G	39_L	0.837	1.00
26_V	66_V	0.836	1.00
18_A	22_V	0.816	1.00
33_A	39_L	0.813	1.00
38_E	47_K	0.812	1.00
67_V	71_V	0.811	1.00
12_A	16_G	0.811	1.00
88_V	92_T	0.810	1.00
11_I	61_I	0.805	1.00
85_K	96_V	0.800	1.00
53_V	57_D	0.799	1.00
25_V	65_V	0.781	1.00
57_D	95_E	0.773	1.00
81_Q	101_V	0.764	1.00
16_G	45_L	0.759	1.00
24_G	71_V	0.755	1.00
11_I	94_L	0.749	1.00
19_A	28_M	0.743	1.00
6_I	92_T	0.739	1.00
32_L	37_A	0.738	1.00
52_E	62_D	0.732	1.00
77_A	101_V	0.723	1.00
17_L	91_M	0.715	1.00
54_G	57_D	0.708	1.00
23_Y	86_Y	0.707	1.00
19_A	25_V	0.700	1.00
12_A	51_V	0.696	1.00
22_V	79_N	0.695	1.00
20_L	27_G	0.688	1.00
89_E	96_V	0.675	1.00
29_A	104_Q	0.669	1.00
67_V	77_A	0.669	1.00
18_A	21_E	0.666	1.00
37_A	42_R	0.663	1.00
11_I	53_V	0.655	1.00
79_N	86_Y	0.652	1.00
14_I	87_A	0.649	1.00
9_E	12_A	0.637	1.00
16_G	46_S	0.637	1.00
15_A	88_V	0.628	1.00
35_G	38_E	0.626	1.00
61_I	96_V	0.621	1.00
33_A	37_A	0.617	1.00
15_A	51_V	0.612	1.00
31_G	50_K	0.609	1.00
4_I	81_Q	0.609	1.00
72_N	104_Q	0.599	1.00
69_Y	73_I	0.595	1.00
16_G	49_V	0.591	1.00
15_A	19_A	0.589	1.00
73_I	77_A	0.586	1.00
38_E	43_K	0.585	1.00
61_I	84_V	0.585	1.00
72_N	76_V	0.584	1.00
32_L	41_G	0.582	1.00
30_G	44_N	0.582	1.00
30_G	47_K	0.577	1.00
20_L	45_L	0.576	1.00
39_L	42_R	0.574	1.00
80_V	101_V	0.569	1.00
87_A	92_T	0.566	1.00
72_N	77_A	0.560	1.00
84_V	88_V	0.554	1.00
32_L	35_G	0.553	1.00
29_A	64_Y	0.546	1.00
59_V	92_T	0.542	1.00
81_Q	98_E	0.536	1.00
20_L	25_V	0.531	1.00
65_V	101_V	0.530	1.00
13_T	46_S	0.530	1.00
30_G	38_E	0.521	1.00
53_V	94_L	0.521	1.00
66_V	104_Q	0.518	1.00
11_I	88_V	0.515	1.00
15_A	84_V	0.514	1.00
43_K	46_S	0.514	1.00
19_A	83_N	0.509	1.00
76_V	79_N	0.509	1.00
17_L	45_L	0.506	1.00
85_K	95_E	0.505	1.00
63_L	101_V	0.504	1.00
50_K	64_Y	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1wh9A	1	0.7757	40.7	0.828	Contact Map
3zeyX	1	0.8318	24.7	0.846	Contact Map
3h90A	3	0.7944	18.8	0.855	Contact Map
4lkbF	4	0.8411	14.3	0.862	Contact Map
3j20C	1	0.8037	13.2	0.864	Contact Map
3j1zP	8	0.7944	12.7	0.866	Contact Map
4ujpE	1	0.8411	12.5	0.866	Contact Map
3m20A	5	0.4206	12	0.867	Contact Map
3bbnC	1	0.8598	11.8	0.867	Contact Map
4w23D	1	0.8505	10.4	0.871	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.