Remorin_C - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Remorin_C - Remorin, C-terminal region

PFAM:	PF03763	Sequences: KRESRAKAWEEAEKAKAENRYKREEAKIQAWENLKKAKAEAELRKIEEKLEKKRAEALEKMKNKLARIHKKAEEKRAAAEAKRGEEALKAEEKAAKIRATGKAPKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	106 (104)
Sequences:	645 (336)
Seq/√Len:	33.0
META:	0.025

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
37_A	41_A	2.921	1.00
26_A	52_K	2.728	1.00
30_A	33_N	2.468	1.00
11_E	17_A	2.457	1.00
39_A	49_K	2.355	0.99
21_Y	79_A	2.334	0.99
97_I	100_T	2.289	0.99
4_S	22_K	2.182	0.99
69_H	73_E	1.998	0.98
81_A	84_G	1.989	0.98
8_A	77_A	1.985	0.98
20_R	77_A	1.963	0.98
24_E	79_A	1.956	0.97
10_E	14_K	1.872	0.97
6_A	21_Y	1.720	0.95
35_K	71_K	1.650	0.93
6_A	20_R	1.648	0.93
80_E	83_R	1.638	0.93
34_L	61_M	1.539	0.91
101_G	104_P	1.527	0.90
24_E	72_A	1.501	0.90
74_E	77_A	1.457	0.88
37_A	52_K	1.414	0.86
29_Q	68_I	1.405	0.86
50_L	76_R	1.387	0.85
46_I	49_K	1.386	0.85
5_R	22_K	1.353	0.84
76_R	81_A	1.348	0.84
79_A	102_K	1.345	0.84
27_K	65_L	1.342	0.83
78_A	93_K	1.334	0.83
4_S	90_A	1.329	0.83
6_A	103_A	1.326	0.83
6_A	17_A	1.322	0.82
65_L	93_K	1.308	0.82
84_G	95_A	1.277	0.80
94_A	101_G	1.226	0.77
36_K	93_K	1.220	0.77
6_A	90_A	1.216	0.77
10_E	13_E	1.206	0.76
8_A	15_A	1.181	0.75
14_K	37_A	1.173	0.74
12_A	17_A	1.147	0.72
16_K	84_G	1.139	0.72
87_A	93_K	1.116	0.70
24_E	28_I	1.081	0.68
39_A	103_A	1.077	0.68
11_E	35_K	1.058	0.66
7_K	11_E	1.057	0.66
5_R	12_A	1.044	0.65
59_E	69_H	1.032	0.64
2_R	5_R	1.028	0.64
85_E	89_K	1.016	0.63
59_E	66_A	1.008	0.62
9_W	74_E	1.007	0.62
39_A	46_I	0.987	0.61
10_E	99_A	0.980	0.60
72_A	76_R	0.956	0.58
11_E	14_K	0.951	0.58
26_A	51_E	0.948	0.58
15_A	79_A	0.935	0.57
34_L	48_E	0.935	0.57
36_K	61_M	0.932	0.56
33_N	73_E	0.926	0.56
40_E	52_K	0.925	0.56
90_A	97_I	0.908	0.54
25_E	28_I	0.894	0.53
50_L	72_A	0.887	0.53
27_K	102_K	0.882	0.52
46_I	60_K	0.876	0.52
39_A	50_L	0.861	0.50
9_W	16_K	0.860	0.50
49_K	68_I	0.856	0.50
67_R	90_A	0.850	0.49
60_K	72_A	0.844	0.49
68_I	84_G	0.843	0.49
76_R	102_K	0.826	0.47
47_E	52_K	0.816	0.47
89_K	98_R	0.812	0.46
27_K	86_E	0.792	0.45
70_K	79_A	0.792	0.45
17_A	21_Y	0.787	0.44
41_A	47_E	0.783	0.44
60_K	66_A	0.783	0.44
5_R	11_E	0.783	0.44
25_E	30_A	0.783	0.44
80_E	94_A	0.763	0.42
53_K	58_L	0.758	0.42
37_A	40_E	0.755	0.42
14_K	21_Y	0.753	0.41
13_E	89_K	0.753	0.41
23_R	54_R	0.753	0.41
42_E	91_E	0.750	0.41
56_E	71_K	0.744	0.41
88_L	99_A	0.744	0.41
43_L	57_A	0.737	0.40
24_E	30_A	0.732	0.40
44_R	67_R	0.727	0.39
37_A	78_A	0.722	0.39
60_K	90_A	0.722	0.39
48_E	55_A	0.715	0.38
42_E	96_K	0.707	0.38
24_E	42_E	0.706	0.38
47_E	103_A	0.703	0.38
4_S	8_A	0.703	0.38
39_A	67_R	0.701	0.37
34_L	46_I	0.700	0.37
38_K	65_L	0.699	0.37
32_E	43_L	0.695	0.37
51_E	60_K	0.692	0.37
61_M	68_I	0.675	0.35
27_K	38_K	0.675	0.35
18_E	48_E	0.673	0.35
67_R	70_K	0.672	0.35
32_E	36_K	0.667	0.35
79_A	89_K	0.666	0.35
46_I	61_M	0.665	0.35
6_A	94_A	0.664	0.35
78_A	82_K	0.663	0.34
63_N	66_A	0.663	0.34
54_R	97_I	0.662	0.34
28_I	42_E	0.659	0.34
47_E	51_E	0.658	0.34
50_L	68_I	0.646	0.33
102_K	105_K	0.646	0.33
65_L	72_A	0.646	0.33
34_L	39_A	0.645	0.33
55_A	92_E	0.636	0.32
20_R	105_K	0.626	0.32
13_E	52_K	0.621	0.31
41_A	103_A	0.604	0.30
54_R	68_I	0.603	0.30
85_E	92_E	0.599	0.30
23_R	48_E	0.598	0.30
20_R	24_E	0.595	0.30
49_K	61_M	0.595	0.30
66_A	77_A	0.594	0.29
44_R	47_E	0.572	0.28
19_N	66_A	0.570	0.28
97_I	103_A	0.563	0.27
92_E	99_A	0.561	0.27
50_L	53_K	0.560	0.27
12_A	46_I	0.550	0.26
49_K	100_T	0.541	0.26
30_A	103_A	0.539	0.26
45_K	64_K	0.535	0.26
34_L	75_K	0.534	0.25
74_E	81_A	0.531	0.25
26_A	105_K	0.529	0.25
45_K	71_K	0.527	0.25
56_E	80_E	0.525	0.25
50_L	62_K	0.512	0.24
12_A	43_L	0.508	0.24
25_E	68_I	0.508	0.24
40_E	48_E	0.507	0.24
88_L	104_P	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3plwA	1	0.0566	3	0.927	Contact Map
2r32A	3	0.3868	3	0.927	Contact Map
3mq9A	4	0.717	2.6	0.93	Contact Map
3ojaB	1	0.934	2.5	0.93	Contact Map
2qagB	1	0	2.4	0.931	Contact Map
1zl8A	1	0.2642	2.2	0.933	Contact Map
4kv9A	2	0	1.6	0.938	Contact Map
4l6yA	2	0.4245	1.6	0.938	Contact Map
2wd5A	1	0.3396	1.5	0.939	Contact Map
2mpeA	1	0.3396	1.4	0.939	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.