FliL - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FliL - Flagellar basal body-associated protein FliL

PFAM:	PF03748	Sequences: YVPLDPPFVVNLADADGGGTRYLKVSVALEVDDEEVAEEAHMPRIRDAILTLLSSKTAEDLSTPEGKERLREELLERINEVLGEGKAGPGKVEDVYFTEFVVQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	103 (98)
Sequences:	21721 (15034)
Seq/√Len:	1518.7
META:	0.873

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
56_K	73_E	3.274	1.00
48_A	77_R	2.701	1.00
54_S	67_K	2.258	1.00
3_P	28_A	2.097	1.00
24_K	99_E	2.032	1.00
57_T	60_D	2.018	1.00
52_L	77_R	1.943	1.00
26_S	99_E	1.931	1.00
75_L	79_N	1.884	1.00
56_K	60_D	1.773	1.00
47_D	71_R	1.769	1.00
30_E	94_D	1.711	1.00
45_I	78_I	1.702	1.00
49_I	74_L	1.678	1.00
47_D	51_T	1.675	1.00
41_H	44_R	1.648	1.00
8_F	46_R	1.609	1.00
63_T	66_G	1.586	1.00
35_E	38_E	1.509	1.00
77_R	80_E	1.490	1.00
21_R	58_A	1.465	1.00
34_E	37_A	1.410	1.00
42_M	46_R	1.406	1.00
29_L	78_I	1.397	1.00
33_D	36_V	1.376	1.00
49_I	78_I	1.370	1.00
10_V	23_L	1.354	1.00
25_V	53_L	1.341	1.00
36_V	39_E	1.293	1.00
72_E	76_E	1.284	1.00
30_E	44_R	1.280	1.00
52_L	56_K	1.271	1.00
74_L	95_V	1.269	1.00
75_L	95_V	1.239	1.00
9_V	24_K	1.228	1.00
52_L	73_E	1.207	1.00
3_P	98_T	1.204	1.00
58_A	62_S	1.199	1.00
75_L	94_D	1.195	1.00
51_T	68_E	1.161	1.00
53_L	74_L	1.158	1.00
26_S	98_T	1.158	1.00
34_E	38_E	1.156	1.00
68_E	72_E	1.152	1.00
28_A	43_P	1.146	1.00
68_E	71_R	1.134	1.00
76_E	80_E	1.110	1.00
32_D	93_E	1.102	1.00
30_E	96_Y	1.088	1.00
2_V	31_V	1.072	1.00
72_E	75_L	1.052	1.00
2_V	37_A	1.036	1.00
48_A	52_L	1.032	1.00
30_E	93_E	1.025	1.00
8_F	49_I	1.022	1.00
79_N	92_V	1.018	1.00
71_R	97_F	1.018	1.00
69_R	73_E	1.002	1.00
58_A	102_V	0.979	1.00
2_V	42_M	0.971	1.00
29_L	92_V	0.968	1.00
35_E	39_E	0.963	1.00
48_A	81_V	0.951	1.00
5_D	42_M	0.934	1.00
33_D	37_A	0.930	1.00
3_P	26_S	0.928	1.00
55_S	64_P	0.920	1.00
6_P	26_S	0.911	1.00
27_V	97_F	0.910	1.00
97_F	100_F	0.905	1.00
71_R	94_D	0.901	1.00
23_L	100_F	0.897	1.00
60_D	69_R	0.879	1.00
73_E	77_R	0.877	1.00
69_R	72_E	0.863	1.00
61_L	102_V	0.860	1.00
61_L	70_L	0.849	1.00
28_A	98_T	0.839	1.00
65_E	69_R	0.823	1.00
27_V	49_I	0.815	1.00
47_D	96_Y	0.804	1.00
56_K	61_L	0.801	1.00
76_E	79_N	0.799	1.00
64_P	68_E	0.795	1.00
4_L	45_I	0.793	1.00
11_N	22_Y	0.780	1.00
66_G	69_R	0.775	1.00
44_R	94_D	0.768	1.00
53_L	70_L	0.768	1.00
8_F	50_L	0.756	1.00
51_T	71_R	0.753	1.00
52_L	74_L	0.750	1.00
79_N	90_G	0.747	1.00
46_R	50_L	0.745	1.00
10_V	50_L	0.736	1.00
32_D	35_E	0.735	1.00
51_T	77_R	0.735	1.00
50_L	54_S	0.733	1.00
32_D	36_V	0.728	1.00
31_V	36_V	0.720	1.00
59_E	62_S	0.717	1.00
15_A	18_G	0.714	1.00
31_V	37_A	0.711	1.00
52_L	70_L	0.711	1.00
12_L	58_A	0.696	1.00
6_P	24_K	0.688	1.00
48_A	80_E	0.674	1.00
88_G	91_K	0.672	1.00
75_L	92_V	0.670	1.00
87_A	90_G	0.664	1.00
78_I	92_V	0.656	1.00
44_R	96_Y	0.642	1.00
60_D	66_G	0.638	1.00
9_V	22_Y	0.636	1.00
49_I	53_L	0.633	1.00
61_L	66_G	0.632	1.00
82_L	90_G	0.626	1.00
29_L	95_V	0.622	1.00
47_D	50_L	0.614	1.00
74_L	78_I	0.612	1.00
3_P	6_P	0.605	1.00
44_R	81_V	0.605	1.00
65_E	68_E	0.604	1.00
79_N	91_K	0.602	1.00
23_L	61_L	0.598	1.00
51_T	67_K	0.597	1.00
44_R	48_A	0.594	1.00
11_N	54_S	0.591	1.00
32_D	39_E	0.590	1.00
27_V	95_V	0.586	1.00
46_R	98_T	0.583	1.00
25_V	100_F	0.582	1.00
4_L	46_R	0.573	1.00
4_L	29_L	0.555	1.00
48_A	51_T	0.528	1.00
33_D	39_E	0.527	1.00
83_G	86_K	0.526	1.00
8_F	12_L	0.525	1.00
48_A	78_I	0.520	1.00
16_D	21_R	0.519	1.00
31_V	93_E	0.516	1.00
23_L	53_L	0.512	1.00
36_V	91_K	0.507	1.00
10_V	53_L	0.504	1.00
55_S	73_E	0.502	1.00
79_N	82_L	0.501	1.00
4_L	42_M	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3bk6A	3	0.9223	14.3	0.851	Contact Map
1winA	1	0.9223	11	0.858	Contact Map
2rpbA	1	0.9223	6	0.874	Contact Map
4fvgA	2	0.9126	5.3	0.877	Contact Map
3k44A	1	0.5534	4.8	0.88	Contact Map
1xdxA	2	0.6893	3	0.891	Contact Map
4w23B	1	0.8835	3	0.891	Contact Map
1ygtA	2	0.6408	2.9	0.892	Contact Map
3j20A	1	0.8641	2.8	0.893	Contact Map
3zey0	1	0.8835	2.8	0.894	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.