TerC - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TerC - Integral membrane protein TerC family

PFAM:	PF03741	Sequences: LTLYLLEIVLSIDNAFVIALIFSKLPPEQQHRALFWGILGALVLRILLILAGAWLLQLFDWILLVGGLFLLWTATKEIHEKEEPENPLEREERRALPVTAASLFAVLVQIELADLVFSLDSVPAAVGITDDPFIVITANVFAILGMRSLAFLLAGLLDRFPYLKYLALAFLLFIGVKLIAE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	181 (177)
Sequences:	41258 (19693)
Seq/√Len:	1480.2
META:	0.874

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
29_Q	32_R	3.628	1.00
31_H	35_F	3.482	1.00
40_G	111_E	3.190	1.00
72_W	76_K	3.004	1.00
151_F	155_G	2.734	1.00
46_I	136_I	2.721	1.00
74_A	172_L	2.507	1.00
104_F	108_V	2.402	1.00
133_F	137_T	2.284	1.00
3_L	125_A	2.281	1.00
31_H	151_F	2.199	1.00
91_E	95_A	2.176	1.00
75_T	79_H	2.141	1.00
7_E	11_S	2.131	1.00
33_A	103_L	2.109	1.00
39_L	43_V	2.049	1.00
155_G	159_R	1.942	1.00
76_K	80_E	1.933	1.00
27_P	30_Q	1.921	1.00
50_L	54_W	1.858	1.00
87_P	90_R	1.791	1.00
42_L	140_V	1.785	1.00
44_L	115_L	1.774	1.00
78_I	165_Y	1.772	1.00
28_E	32_R	1.737	1.00
35_F	39_L	1.691	1.00
6_L	128_I	1.676	1.00
25_L	33_A	1.647	1.00
32_R	103_L	1.647	1.00
108_V	112_L	1.641	1.00
51_A	54_W	1.608	1.00
26_P	29_Q	1.596	1.00
176_V	180_A	1.573	1.00
23_S	158_D	1.545	1.00
92_E	96_L	1.511	1.00
50_L	132_P	1.501	1.00
15_A	19_A	1.468	1.00
32_R	36_W	1.467	1.00
43_V	47_L	1.444	1.00
87_P	91_E	1.433	1.00
177_K	181_E	1.430	1.00
67_G	179_I	1.402	1.00
46_I	50_L	1.396	1.00
99_T	102_S	1.380	1.00
54_W	58_L	1.379	1.00
54_W	57_Q	1.368	1.00
4_Y	141_F	1.346	1.00
101_A	106_V	1.342	1.00
44_L	111_E	1.339	1.00
53_A	126_V	1.329	1.00
47_L	51_A	1.326	1.00
55_L	62_I	1.321	1.00
25_L	106_V	1.319	1.00
63_L	181_E	1.317	1.00
76_K	79_H	1.317	1.00
72_W	75_T	1.314	1.00
140_V	144_L	1.292	1.00
155_G	158_D	1.287	1.00
42_L	143_I	1.285	1.00
150_A	154_A	1.282	1.00
5_L	9_V	1.280	1.00
25_L	102_S	1.279	1.00
71_L	175_G	1.270	1.00
4_Y	8_I	1.252	1.00
89_E	93_R	1.237	1.00
86_N	89_E	1.232	1.00
53_A	57_Q	1.228	1.00
162_Y	165_Y	1.220	1.00
33_A	110_I	1.202	1.00
137_T	141_F	1.175	1.00
132_P	136_I	1.154	1.00
98_V	105_A	1.142	1.00
88_L	93_R	1.135	1.00
40_G	44_L	1.131	1.00
173_F	177_K	1.122	1.00
105_A	109_Q	1.116	1.00
108_V	111_E	1.065	1.00
93_R	100_A	1.064	1.00
8_I	12_I	1.061	1.00
36_W	40_G	1.054	1.00
82_E	88_L	1.040	1.00
69_F	73_T	1.037	1.00
32_R	35_F	1.032	1.00
79_H	162_Y	1.030	1.00
173_F	176_V	1.028	1.00
27_P	31_H	1.000	1.00
64_L	68_L	0.991	1.00
88_L	92_E	0.980	1.00
15_A	18_I	0.978	1.00
148_S	152_L	0.956	1.00
152_L	155_G	0.943	1.00
74_A	168_L	0.935	1.00
36_W	107_L	0.933	1.00
28_E	31_H	0.930	1.00
56_L	63_L	0.918	1.00
139_N	142_A	0.912	1.00
49_I	53_A	0.911	1.00
105_A	108_V	0.911	1.00
101_A	105_A	0.910	1.00
33_A	107_L	0.909	1.00
102_S	105_A	0.908	1.00
145_G	149_L	0.905	1.00
48_L	115_L	0.905	1.00
24_K	86_N	0.903	1.00
133_F	136_I	0.896	1.00
23_S	30_Q	0.894	1.00
112_L	116_V	0.891	1.00
86_N	90_R	0.884	1.00
125_A	135_V	0.879	1.00
93_R	96_L	0.875	1.00
60_D	63_L	0.875	1.00
68_L	72_W	0.872	1.00
149_L	152_L	0.872	1.00
161_P	165_Y	0.871	1.00
35_F	151_F	0.870	1.00
22_F	33_A	0.855	1.00
92_E	95_A	0.853	1.00
136_I	140_V	0.852	1.00
98_V	101_A	0.852	1.00
49_I	139_N	0.851	1.00
69_F	119_L	0.848	1.00
60_D	64_L	0.845	1.00
91_E	94_R	0.844	1.00
157_L	163_L	0.838	1.00
90_R	95_A	0.835	1.00
104_F	107_L	0.834	1.00
156_L	159_R	0.833	1.00
127_G	174_I	0.832	1.00
168_L	172_L	0.831	1.00
144_L	148_S	0.830	1.00
53_A	56_L	0.827	1.00
41_A	45_R	0.827	1.00
45_R	114_D	0.826	1.00
49_I	135_V	0.825	1.00
8_I	15_A	0.816	1.00
52_G	126_V	0.814	1.00
139_N	143_I	0.814	1.00
44_L	47_L	0.811	1.00
81_K	165_Y	0.810	1.00
89_E	92_E	0.810	1.00
19_A	157_L	0.810	1.00
50_L	53_A	0.809	1.00
156_L	160_F	0.802	1.00
77_E	168_L	0.801	1.00
88_L	95_A	0.798	1.00
126_V	129_T	0.798	1.00
19_A	154_A	0.798	1.00
64_L	179_I	0.794	1.00
47_L	50_L	0.790	1.00
44_L	118_S	0.788	1.00
165_Y	169_A	0.786	1.00
19_A	23_S	0.785	1.00
129_T	133_F	0.784	1.00
61_W	64_L	0.784	1.00
21_I	109_Q	0.780	1.00
87_P	92_E	0.777	1.00
69_F	72_W	0.777	1.00
157_L	164_K	0.769	1.00
21_I	113_A	0.767	1.00
74_A	175_G	0.765	1.00
2_T	6_L	0.763	1.00
87_P	93_R	0.760	1.00
88_L	91_E	0.759	1.00
38_I	42_L	0.758	1.00
3_L	134_I	0.754	1.00
88_L	112_L	0.751	1.00
90_R	93_R	0.749	1.00
104_F	111_E	0.740	1.00
170_F	174_I	0.740	1.00
36_W	39_L	0.723	1.00
2_T	7_E	0.721	1.00
129_T	135_V	0.715	1.00
92_E	98_V	0.714	1.00
57_Q	130_D	0.714	1.00
38_I	147_R	0.711	1.00
3_L	135_V	0.710	1.00
156_L	163_L	0.703	1.00
97_P	100_A	0.701	1.00
50_L	136_I	0.698	1.00
34_L	151_F	0.697	1.00
56_L	126_V	0.691	1.00
79_H	82_E	0.691	1.00
60_D	181_E	0.687	1.00
89_E	109_Q	0.686	1.00
109_Q	113_A	0.685	1.00
29_Q	33_A	0.684	1.00
62_I	66_G	0.675	1.00
95_A	98_V	0.670	1.00
87_P	94_R	0.669	1.00
8_I	149_L	0.668	1.00
169_A	173_F	0.664	1.00
26_P	102_S	0.664	1.00
12_I	15_A	0.663	1.00
56_L	59_F	0.662	1.00
93_R	98_V	0.661	1.00
22_F	34_L	0.660	1.00
8_I	148_S	0.658	1.00
102_S	106_V	0.654	1.00
152_L	156_L	0.650	1.00
71_L	75_T	0.648	1.00
89_E	96_L	0.647	1.00
88_L	96_L	0.647	1.00
89_E	98_V	0.640	1.00
160_F	163_L	0.637	1.00
18_I	22_F	0.634	1.00
25_L	29_Q	0.633	1.00
4_Y	137_T	0.628	1.00
30_Q	154_A	0.626	1.00
20_L	23_S	0.623	1.00
142_A	147_R	0.623	1.00
42_L	147_R	0.619	1.00
125_A	128_I	0.617	1.00
96_L	100_A	0.616	1.00
86_N	93_R	0.614	1.00
114_D	120_D	0.612	1.00
39_L	42_L	0.611	1.00
21_I	106_V	0.610	1.00
17_V	117_F	0.609	1.00
94_R	97_P	0.602	1.00
2_T	5_L	0.599	1.00
30_Q	34_L	0.597	1.00
153_L	156_L	0.596	1.00
49_I	52_G	0.595	1.00
93_R	99_T	0.593	1.00
78_I	168_L	0.591	1.00
58_L	61_W	0.590	1.00
130_D	133_F	0.587	1.00
92_E	97_P	0.580	1.00
86_N	112_L	0.580	1.00
96_L	102_S	0.576	1.00
35_F	147_R	0.576	1.00
89_E	95_A	0.571	1.00
114_D	143_I	0.571	1.00
61_W	65_V	0.570	1.00
158_D	161_P	0.568	1.00
129_T	134_I	0.567	1.00
40_G	107_L	0.564	1.00
98_V	102_S	0.564	1.00
143_I	147_R	0.561	1.00
31_H	34_L	0.558	1.00
169_A	172_L	0.558	1.00
151_F	154_A	0.558	1.00
89_E	94_R	0.558	1.00
100_A	104_F	0.552	1.00
107_L	111_E	0.550	1.00
8_I	42_L	0.550	1.00
86_N	91_E	0.547	1.00
3_L	129_T	0.547	1.00
71_L	179_I	0.538	1.00
44_L	48_L	0.527	1.00
29_Q	103_L	0.526	1.00
30_Q	158_D	0.523	1.00
88_L	98_V	0.523	1.00
24_K	80_E	0.520	1.00
48_L	51_A	0.519	1.00
57_Q	60_D	0.518	1.00
33_A	106_V	0.515	1.00
51_A	55_L	0.512	1.00
113_A	116_V	0.510	1.00
114_D	118_S	0.510	1.00
82_E	90_R	0.507	1.00
161_P	164_K	0.506	1.00
81_K	164_K	0.505	1.00
18_I	21_I	0.503	1.00
55_L	59_F	0.503	1.00
131_D	134_I	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2cfqA	1	0.5359	43.7	0.893	Contact Map
4w6vA	1	0.4807	43.5	0.893	Contact Map
3o7qA	1	0.989	40.8	0.895	Contact Map
2gfpA	2	0.9779	40.5	0.895	Contact Map
4xnjA	1	1	29.9	0.902	Contact Map
1pw4A	1	0.5304	29.3	0.903	Contact Map
2wswA	3	0.4586	23	0.908	Contact Map
3wdoA	1	0.9834	22.4	0.908	Contact Map
4m64A	1	0.989	17.3	0.913	Contact Map
4ikvA	1	0.4807	16.7	0.913	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.