CxxCxxCC - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CxxCxxCC - Putative zinc- or iron-chelating domain

PFAM:	PF03692	Sequences: DCDGCGACCRPGGVPLTPEDIERLAKHLGLSEEEFLERYTREDGPCPFLDDDTGRCSIYEVRPLACRLYPFWDKEEFEWLPETCA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	85 (71)
Sequences:	61160 (36263)
Seq/√Len:	4303.6
META:	0.934

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
59_Y	62_R	3.615	1.00
50_D	57_S	3.259	1.00
64_L	68_L	2.938	1.00
27_H	61_V	2.690	1.00
50_D	53_T	2.064	1.00
48_F	58_I	1.981	1.00
50_D	55_R	1.901	1.00
4_G	55_R	1.873	1.00
17_T	20_D	1.682	1.00
10_R	45_P	1.664	1.00
58_I	61_V	1.633	1.00
48_F	57_S	1.578	1.00
36_L	40_T	1.517	1.00
6_G	49_L	1.516	1.00
7_A	10_R	1.309	1.00
65_A	72_W	1.258	1.00
34_E	38_R	1.251	1.00
19_E	22_E	1.238	1.00
35_F	38_R	1.230	1.00
42_E	45_P	1.222	1.00
31_S	34_E	1.208	1.00
35_F	39_Y	1.168	1.00
6_G	55_R	1.165	1.00
27_H	60_E	1.140	1.00
34_E	39_Y	1.130	1.00
45_P	49_L	1.127	1.00
31_S	35_F	1.099	1.00
52_D	55_R	1.041	1.00
18_P	22_E	1.030	1.00
23_R	26_K	1.022	1.00
25_A	28_L	1.017	1.00
35_F	40_T	0.997	1.00
50_D	54_G	0.990	1.00
32_E	36_L	0.963	1.00
26_K	29_G	0.955	1.00
51_D	54_G	0.939	1.00
38_R	41_R	0.932	1.00
14_V	17_T	0.929	1.00
51_D	55_R	0.923	1.00
34_E	37_E	0.920	1.00
36_L	39_Y	0.920	1.00
12_G	15_P	0.915	1.00
65_A	68_L	0.910	1.00
25_A	29_G	0.906	1.00
45_P	51_D	0.880	1.00
24_L	28_L	0.880	1.00
3_D	55_R	0.879	1.00
14_V	20_D	0.878	1.00
11_P	14_V	0.859	1.00
14_V	65_A	0.841	1.00
6_G	10_R	0.840	1.00
17_T	64_L	0.836	1.00
16_L	20_D	0.835	1.00
11_P	15_P	0.832	1.00
33_E	36_L	0.830	1.00
28_L	31_S	0.829	1.00
62_R	67_R	0.826	1.00
22_E	26_K	0.826	1.00
68_L	72_W	0.823	1.00
68_L	71_F	0.822	1.00
16_L	21_I	0.820	1.00
10_R	54_G	0.814	1.00
21_I	25_A	0.809	1.00
20_D	23_R	0.796	1.00
32_E	35_F	0.788	1.00
37_E	40_T	0.784	1.00
10_R	49_L	0.784	1.00
65_A	69_Y	0.780	1.00
24_L	58_I	0.777	1.00
6_G	54_G	0.774	1.00
19_E	23_R	0.768	1.00
30_L	35_F	0.744	1.00
66_C	69_Y	0.734	1.00
37_E	41_R	0.730	1.00
30_L	33_E	0.718	1.00
49_L	54_G	0.710	1.00
13_G	17_T	0.707	1.00
22_E	25_A	0.695	1.00
16_L	24_L	0.692	1.00
11_P	44_G	0.689	1.00
33_E	38_R	0.683	1.00
30_L	34_E	0.672	1.00
17_T	22_E	0.671	1.00
30_L	39_Y	0.668	1.00
7_A	70_P	0.666	1.00
7_A	69_Y	0.650	1.00
49_L	55_R	0.649	1.00
30_L	38_R	0.649	1.00
44_G	47_P	0.646	1.00
6_G	52_D	0.644	1.00
33_E	37_E	0.632	1.00
13_G	44_G	0.628	1.00
18_P	21_I	0.597	1.00
3_D	6_G	0.593	1.00
19_E	64_L	0.591	1.00
34_E	40_T	0.582	1.00
4_G	49_L	0.570	1.00
36_L	41_R	0.562	1.00
24_L	27_H	0.559	1.00
29_G	32_E	0.554	1.00
12_G	17_T	0.552	1.00
20_D	24_L	0.542	1.00
42_E	47_P	0.531	1.00
26_K	30_L	0.512	1.00
10_R	53_T	0.503	1.00
23_R	61_V	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1gteA	4	0.3647	4.5	0.868	Contact Map
1bc6A	1	0.4353	3.5	0.875	Contact Map
4p3xA	1	0.9882	3.1	0.878	Contact Map
2gmhA	1	0.3529	3.1	0.878	Contact Map
1h98A	1	0.4353	3	0.879	Contact Map
1m4fA	1	0.1176	2.8	0.881	Contact Map
2h88B	1	0.3882	2.8	0.881	Contact Map
2wdqB	1	0.3882	2.4	0.885	Contact Map
2bs2B	1	0.3765	2	0.889	Contact Map
1sj1A	2	0.2588	2	0.891	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.