UPF0158 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

UPF0158 - Uncharacterised protein family (UPF0158)

PFAM:	PF03682	Sequences: QRPLTIDLEDLIDALEFASDEHESYLDLETGEVVFVSDDDDDEEEDELEEEIEEDPDRYLRIPPLFSIEEYRIMEDFAASKVEDPDLRERLLRAIRGKGAFRRFKDVLYRYPEERERWFAFRDERLRERAIEWLEENGIEPVFEEDLDLPKNVLEKL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	157 (131)
Sequences:	2974 (2066)
Seq/√Len:	180.5
META:	0.927

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
27_D	58_R	4.239	1.00
78_A	95_I	4.024	1.00
115_R	119_F	3.482	1.00
73_I	129_R	3.363	1.00
29_E	58_R	2.808	1.00
116_E	120_A	2.362	1.00
125_R	128_E	2.203	1.00
127_R	131_I	2.117	1.00
87_L	114_E	2.095	1.00
71_Y	101_F	2.017	1.00
102_R	106_D	1.877	1.00
76_D	125_R	1.850	1.00
14_A	19_S	1.848	1.00
71_Y	75_E	1.839	1.00
70_E	122_R	1.774	1.00
105_K	119_F	1.761	1.00
72_R	75_E	1.747	1.00
60_L	137_N	1.737	1.00
16_E	19_S	1.706	1.00
15_L	130_A	1.691	1.00
71_Y	96_R	1.671	1.00
24_S	35_F	1.658	1.00
109_Y	115_R	1.657	1.00
43_E	46_D	1.621	1.00
23_E	61_R	1.599	1.00
66_F	69_E	1.586	1.00
87_L	111_Y	1.550	1.00
14_A	33_V	1.467	1.00
76_D	121_F	1.447	1.00
45_E	48_L	1.432	1.00
70_E	73_I	1.393	1.00
78_A	92_L	1.385	1.00
124_E	127_R	1.368	1.00
90_R	93_R	1.365	1.00
100_A	103_R	1.347	1.00
64_P	67_S	1.302	1.00
28_L	60_L	1.290	1.00
73_I	126_L	1.290	1.00
97_G	103_R	1.281	1.00
90_R	111_Y	1.281	1.00
14_A	18_A	1.276	1.00
109_Y	119_F	1.272	1.00
74_M	104_F	1.272	1.00
73_I	125_R	1.265	1.00
71_Y	103_R	1.263	1.00
26_L	31_G	1.246	1.00
71_Y	95_I	1.224	1.00
48_L	51_E	1.202	1.00
22_H	35_F	1.201	1.00
95_I	100_A	1.178	1.00
42_D	45_E	1.152	1.00
27_D	59_Y	1.151	1.00
82_V	87_L	1.126	1.00
74_M	95_I	1.113	1.00
131_I	135_E	1.085	1.00
103_R	106_D	1.081	1.00
88_R	92_L	1.068	1.00
12_I	18_A	1.062	1.00
108_L	112_P	1.062	1.00
114_E	117_R	1.053	1.00
15_L	19_S	1.045	1.00
50_E	53_E	1.044	1.00
12_I	15_L	1.038	1.00
25_Y	61_R	1.032	1.00
99_G	103_R	1.017	0.99
10_D	14_A	0.999	0.99
135_E	141_P	0.993	0.99
99_G	118_W	0.988	0.99
74_M	101_F	0.988	0.99
90_R	107_V	0.986	0.99
82_V	91_L	0.980	0.99
108_L	111_Y	0.974	0.99
15_L	18_A	0.963	0.99
94_A	107_V	0.953	0.99
120_A	123_D	0.951	0.99
26_L	133_W	0.947	0.99
14_A	17_F	0.931	0.99
79_A	92_L	0.922	0.99
41_D	45_E	0.921	0.99
75_E	95_I	0.916	0.99
86_D	90_R	0.901	0.99
17_F	20_D	0.900	0.99
122_R	126_L	0.888	0.99
134_L	137_N	0.877	0.98
91_L	107_V	0.876	0.98
129_R	134_L	0.875	0.98
87_L	107_V	0.869	0.98
28_L	59_Y	0.864	0.98
28_L	58_R	0.863	0.98
67_S	71_Y	0.863	0.98
69_E	72_R	0.862	0.98
67_S	101_F	0.859	0.98
49_E	53_E	0.852	0.98
72_R	76_D	0.848	0.98
44_E	48_L	0.834	0.98
18_A	24_S	0.828	0.98
101_F	105_K	0.826	0.98
59_Y	63_P	0.818	0.98
27_D	33_V	0.817	0.97
13_D	17_F	0.816	0.97
65_L	70_E	0.815	0.97
40_D	43_E	0.814	0.97
71_Y	100_A	0.807	0.97
124_E	128_E	0.800	0.97
67_S	70_E	0.798	0.97
85_P	89_E	0.796	0.97
65_L	73_I	0.787	0.97
41_D	48_L	0.785	0.97
74_M	91_L	0.784	0.97
93_R	110_R	0.779	0.97
49_E	52_I	0.776	0.97
10_D	13_D	0.772	0.96
42_D	46_D	0.769	0.96
130_A	134_L	0.767	0.96
128_E	132_E	0.759	0.96
75_E	78_A	0.755	0.96
106_D	109_Y	0.749	0.96
63_P	67_S	0.735	0.95
26_L	134_L	0.733	0.95
11_L	134_L	0.731	0.95
82_V	85_P	0.730	0.95
78_A	89_E	0.727	0.95
102_R	105_K	0.707	0.94
71_Y	99_G	0.695	0.94
107_V	111_Y	0.693	0.94
80_S	121_F	0.679	0.93
70_E	105_K	0.676	0.93
15_L	20_D	0.676	0.93
46_D	49_E	0.668	0.92
11_L	17_F	0.662	0.92
51_E	55_D	0.659	0.92
60_L	139_I	0.652	0.91
104_F	118_W	0.650	0.91
70_E	137_N	0.650	0.91
12_I	19_S	0.649	0.91
14_A	24_S	0.647	0.91
62_I	65_L	0.644	0.91
19_S	22_H	0.641	0.91
75_E	79_A	0.639	0.91
123_D	126_L	0.627	0.90
63_P	133_W	0.627	0.90
22_H	25_Y	0.627	0.90
71_Y	78_A	0.624	0.90
123_D	127_R	0.621	0.89
27_D	32_E	0.621	0.89
10_D	18_A	0.620	0.89
91_L	94_A	0.618	0.89
16_E	130_A	0.618	0.89
78_A	88_R	0.614	0.89
59_Y	62_I	0.614	0.89
13_D	18_A	0.609	0.88
120_A	124_E	0.608	0.88
100_A	118_W	0.607	0.88
62_I	67_S	0.606	0.88
131_I	141_P	0.603	0.88
18_A	35_F	0.599	0.88
17_F	22_H	0.593	0.87
87_L	108_L	0.592	0.87
108_L	115_R	0.592	0.87
78_A	82_V	0.589	0.87
26_L	131_I	0.585	0.86
86_D	89_E	0.577	0.86
117_R	120_A	0.576	0.86
33_V	96_R	0.576	0.86
75_E	96_R	0.575	0.85
63_P	73_I	0.574	0.85
93_R	108_L	0.572	0.85
128_E	131_I	0.568	0.85
33_V	62_I	0.567	0.85
105_K	109_Y	0.563	0.84
15_L	133_W	0.560	0.84
84_D	91_L	0.552	0.83
22_H	127_R	0.551	0.83
47_E	51_E	0.543	0.82
55_D	59_Y	0.541	0.82
11_L	14_A	0.537	0.81
67_S	119_F	0.536	0.81
84_D	87_L	0.535	0.81
11_L	18_A	0.528	0.80
78_A	105_K	0.524	0.80
114_E	121_F	0.523	0.80
17_F	24_S	0.523	0.80
71_Y	74_M	0.522	0.80
94_A	102_R	0.518	0.79
89_E	99_G	0.518	0.79
117_R	124_E	0.513	0.78
71_Y	105_K	0.511	0.78
41_D	54_E	0.508	0.78
20_D	65_L	0.507	0.78
124_E	131_I	0.506	0.77
11_L	19_S	0.505	0.77
38_D	41_D	0.503	0.77
97_G	100_A	0.502	0.77
79_A	85_P	0.502	0.77
43_E	52_I	0.502	0.77
16_E	20_D	0.500	0.77

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3cmuA	1	0.8471	31.8	0.917	Contact Map
4jrbA	1	0.9236	28.7	0.919	Contact Map
2yfvC	1	0.2102	27.9	0.92	Contact Map
3tbiA	1	0.3439	27.1	0.92	Contact Map
3ka5A	2	0.3185	13.2	0.931	Contact Map
3lyvA	2	0.3185	13	0.931	Contact Map
3kb4A	2	0.6051	12.7	0.931	Contact Map
3k2tA	1	0.293	11.6	0.932	Contact Map
2cqaA	1	0.3121	10	0.934	Contact Map
2w3qA	2	0.2739	9.6	0.935	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.