TCP - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TCP - TCP family transcription factor

PFAM:	PF03634	Sequences: TSKKDRHSKIYTAQGPRDRRVRLSIGIARKFFDLQDMLGFDKASKTLEWLLTKSKPAIKELVQSKSTGTIPANFSSLSSSSRSECEVVSGEDEEETLLNFDSGNSSSSLKSSGCSSKKKKSKKSSKLSASSPLAKESRAKARARARERTREKMCMK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	156 (152)
Sequences:	701 (576)
Seq/√Len:	46.7
META:	0.029

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
21_V	25_I	5.051	1.00
25_I	47_L	4.274	1.00
21_V	47_L	3.118	1.00
86_E	89_S	2.991	1.00
81_S	84_E	2.150	1.00
16_P	56_P	2.142	1.00
80_S	83_S	2.137	1.00
32_F	46_T	2.128	1.00
138_R	145_A	2.059	1.00
138_R	141_A	2.058	1.00
36_D	43_A	2.039	0.99
81_S	85_C	2.036	0.99
141_A	145_A	2.023	0.99
11_Y	16_P	1.953	0.99
29_R	33_D	1.898	0.99
4_K	7_H	1.866	0.99
136_E	140_K	1.846	0.99
127_L	130_S	1.750	0.98
27_I	53_K	1.725	0.98
141_A	144_R	1.706	0.98
47_L	51_L	1.696	0.98
80_S	84_E	1.676	0.98
54_S	57_A	1.675	0.98
143_A	146_R	1.634	0.97
6_R	33_D	1.592	0.97
91_E	94_E	1.552	0.97
25_I	62_V	1.551	0.97
21_V	33_D	1.541	0.96
104_N	107_S	1.503	0.96
26_G	43_A	1.459	0.95
26_G	47_L	1.453	0.95
138_R	144_R	1.439	0.95
126_K	129_A	1.434	0.95
73_N	81_S	1.406	0.94
119_K	122_K	1.402	0.94
107_S	110_K	1.398	0.94
141_A	146_R	1.380	0.93
125_S	129_A	1.379	0.93
40_F	54_S	1.343	0.92
48_E	53_K	1.322	0.92
103_G	106_S	1.294	0.91
145_A	148_R	1.292	0.91
4_K	33_D	1.291	0.91
77_L	83_S	1.289	0.91
48_E	52_T	1.278	0.90
136_E	146_R	1.278	0.90
130_S	134_A	1.273	0.90
67_T	72_A	1.270	0.90
73_N	76_S	1.260	0.90
54_S	60_E	1.248	0.89
125_S	130_S	1.242	0.89
11_Y	64_S	1.235	0.89
5_D	9_K	1.221	0.88
77_L	81_S	1.218	0.88
12_T	15_G	1.193	0.87
144_R	148_R	1.192	0.87
27_I	64_S	1.191	0.87
30_K	51_L	1.179	0.86
138_R	146_R	1.179	0.86
100_F	103_G	1.155	0.85
101_D	104_N	1.144	0.85
60_E	139_A	1.140	0.85
149_T	152_K	1.134	0.84
37_M	42_K	1.131	0.84
130_S	133_L	1.126	0.84
84_E	89_S	1.117	0.83
79_S	82_R	1.105	0.83
138_R	143_A	1.104	0.83
21_V	43_A	1.092	0.82
82_R	85_C	1.086	0.81
74_F	77_L	1.080	0.81
138_R	142_R	1.075	0.81
124_S	127_L	1.073	0.81
32_F	42_K	1.055	0.80
31_F	41_D	1.032	0.78
6_R	9_K	1.028	0.78
104_N	108_S	1.013	0.77
77_L	82_R	1.003	0.76
138_R	148_R	1.003	0.76
30_K	54_S	1.002	0.76
42_K	46_T	0.988	0.75
45_K	150_R	0.983	0.75
106_S	109_L	0.980	0.74
13_A	131_S	0.979	0.74
82_R	86_E	0.979	0.74
26_G	63_Q	0.972	0.74
75_S	79_S	0.968	0.73
2_S	51_L	0.955	0.72
10_I	37_M	0.946	0.72
43_A	61_L	0.942	0.71
52_T	55_K	0.941	0.71
133_L	139_A	0.931	0.70
80_S	85_C	0.930	0.70
90_G	94_E	0.929	0.70
141_A	148_R	0.928	0.70
145_A	149_T	0.916	0.69
135_K	138_R	0.909	0.69
30_K	52_T	0.905	0.68
21_V	65_K	0.905	0.68
121_S	124_S	0.904	0.68
105_S	109_L	0.899	0.68
118_K	122_K	0.888	0.67
32_F	37_M	0.873	0.65
26_G	62_V	0.862	0.64
112_S	115_S	0.858	0.64
51_L	139_A	0.855	0.64
84_E	88_V	0.852	0.64
114_C	119_K	0.851	0.63
59_K	153_M	0.850	0.63
48_E	66_S	0.847	0.63
115_S	118_K	0.844	0.63
26_G	33_D	0.844	0.63
29_R	32_F	0.840	0.62
92_D	95_E	0.836	0.62
11_Y	150_R	0.829	0.61
113_G	116_S	0.827	0.61
103_G	114_C	0.820	0.61
4_K	9_K	0.818	0.60
110_K	116_S	0.800	0.59
115_S	119_K	0.795	0.58
10_I	42_K	0.793	0.58
73_N	83_S	0.790	0.58
29_R	42_K	0.790	0.58
115_S	121_S	0.782	0.57
25_I	55_K	0.774	0.56
126_K	130_S	0.774	0.56
52_T	66_S	0.772	0.56
105_S	110_K	0.767	0.55
118_K	121_S	0.765	0.55
27_I	54_S	0.758	0.55
46_T	51_L	0.756	0.54
14_Q	47_L	0.749	0.54
40_F	45_K	0.748	0.54
56_P	65_K	0.745	0.53
66_S	150_R	0.744	0.53
77_L	84_E	0.744	0.53
138_R	149_T	0.742	0.53
84_E	87_V	0.741	0.53
83_S	89_S	0.741	0.53
109_L	112_S	0.730	0.52
109_L	113_G	0.725	0.51
57_A	60_E	0.722	0.51
62_V	65_K	0.721	0.51
73_N	79_S	0.721	0.51
27_I	60_E	0.721	0.51
16_P	48_E	0.716	0.50
148_R	152_K	0.713	0.50
36_D	47_L	0.712	0.50
116_S	121_S	0.704	0.49
98_L	115_S	0.702	0.49
56_P	64_S	0.702	0.49
29_R	46_T	0.702	0.49
112_S	121_S	0.700	0.49
67_T	70_I	0.699	0.49
72_A	82_R	0.694	0.48
52_T	61_L	0.688	0.48
115_S	120_K	0.688	0.48
11_Y	47_L	0.687	0.48
120_K	126_K	0.686	0.47
35_Q	44_S	0.685	0.47
14_Q	33_D	0.678	0.47
3_K	42_K	0.674	0.46
58_I	143_A	0.673	0.46
76_S	79_S	0.672	0.46
77_L	80_S	0.668	0.46
120_K	123_K	0.667	0.46
136_E	148_R	0.667	0.46
30_K	146_R	0.661	0.45
116_S	119_K	0.658	0.45
37_M	46_T	0.651	0.44
26_G	51_L	0.650	0.44
30_K	60_E	0.645	0.43
58_I	144_R	0.645	0.43
17_R	20_R	0.643	0.43
104_N	109_L	0.643	0.43
144_R	149_T	0.643	0.43
133_L	151_E	0.639	0.43
71_P	82_R	0.637	0.43
5_D	8_S	0.637	0.43
97_L	100_F	0.630	0.42
15_G	18_D	0.629	0.42
112_S	116_S	0.625	0.41
142_R	148_R	0.620	0.41
10_I	29_R	0.619	0.41
72_A	77_L	0.613	0.40
136_E	144_R	0.612	0.40
111_S	114_C	0.610	0.40
53_K	60_E	0.607	0.40
27_I	40_F	0.606	0.40
36_D	51_L	0.599	0.39
32_F	43_A	0.596	0.39
99_N	103_G	0.591	0.38
27_I	32_F	0.585	0.38
31_F	44_S	0.578	0.37
90_G	93_E	0.578	0.37
13_A	41_D	0.577	0.37
27_I	42_K	0.577	0.37
109_L	114_C	0.574	0.37
114_C	117_K	0.574	0.37
21_V	41_D	0.573	0.37
104_N	116_S	0.573	0.37
78_S	85_C	0.573	0.37
74_F	79_S	0.572	0.36
80_S	87_V	0.569	0.36
87_V	91_E	0.563	0.36
138_R	152_K	0.551	0.35
26_G	36_D	0.548	0.34
75_S	78_S	0.548	0.34
16_P	62_V	0.546	0.34
117_K	122_K	0.545	0.34
68_G	72_A	0.532	0.33
27_I	30_K	0.528	0.33
45_K	51_L	0.527	0.32
99_N	153_M	0.524	0.32
22_R	28_A	0.521	0.32
132_P	139_A	0.520	0.32
125_S	128_S	0.515	0.31
71_P	77_L	0.511	0.31
73_N	80_S	0.511	0.31
40_F	43_A	0.510	0.31
25_I	42_K	0.506	0.31
27_I	43_A	0.505	0.31
108_S	111_S	0.505	0.31
140_K	143_A	0.503	0.30
27_I	37_M	0.502	0.30
125_S	131_S	0.502	0.30
74_F	80_S	0.501	0.30
80_S	86_E	0.500	0.30

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2g3qA	1	0.1923	39.2	0.943	Contact Map
1z96A	1	0.1603	22.1	0.949	Contact Map
2dakA	1	0.3205	20.6	0.95	Contact Map
2knzA	1	0.25	20.5	0.95	Contact Map
2dagA	1	0.3782	19.9	0.95	Contact Map
2cwbA	1	0.2051	18.2	0.951	Contact Map
4dx8H	1	0.3462	15.4	0.953	Contact Map
4un2B	1	0.1859	14.4	0.953	Contact Map
1ifyA	1	0.2308	14	0.954	Contact Map
2mr9A	1	0.1987	13.4	0.954	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.