EIIBC-GUT_N - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

EIIBC-GUT_N - Sorbitol phosphotransferase enzyme II N-terminus

PFAM:	PF03612	Sequences: SVKIEKGSGGWGGPLVITPTEEKNKIVSVTGGGIPPVADKIAELTGAEAVDGFKTSVPDEEIACAVIDCGGTLRCGVYPKKRIPTINITPTGKSGPLAQFITEDIYVSGVKEENISLADGSEAAAAAAAAAAEAAAEKEKKYDTSKKITEQSAEGGKKGLIAKIGRGMGKVVATFYQAGRDTID	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	184 (183)
Sequences:	715 (483)
Seq/√Len:	35.7
META:	0.47

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_I	63_A	3.908	1.00
111_K	114_N	3.881	1.00
82_R	105_I	3.245	1.00
28_S	35_P	3.215	1.00
39_D	43_E	3.156	1.00
44_L	117_L	3.133	1.00
84_P	105_I	3.127	1.00
22_E	60_E	3.099	1.00
4_I	86_I	3.090	1.00
82_R	104_D	3.050	1.00
27_V	62_I	3.027	1.00
59_D	81_K	3.006	1.00
25_K	61_E	2.712	1.00
3_K	16_V	2.610	1.00
5_E	116_S	2.606	1.00
102_T	105_I	2.302	0.99
26_I	41_I	2.149	0.99
41_I	64_C	2.069	0.99
92_G	106_Y	2.012	0.98
82_R	102_T	2.002	0.98
9_G	109_G	1.917	0.98
171_V	175_F	1.848	0.97
33_G	51_D	1.840	0.97
179_G	183_I	1.827	0.97
73_L	77_V	1.819	0.97
44_L	115_I	1.763	0.96
34_I	39_D	1.754	0.96
87_N	106_Y	1.735	0.96
93_K	106_Y	1.692	0.95
37_V	115_I	1.688	0.95
5_E	114_N	1.668	0.95
20_T	24_N	1.663	0.95
4_I	41_I	1.642	0.95
27_V	65_A	1.635	0.94
164_I	168_M	1.634	0.94
42_A	49_A	1.602	0.94
75_C	87_N	1.592	0.94
28_S	34_I	1.573	0.93
47_A	63_A	1.558	0.93
59_D	62_I	1.543	0.92
19_P	45_T	1.529	0.92
40_K	44_L	1.507	0.92
4_I	17_I	1.488	0.91
175_F	178_A	1.480	0.91
40_K	43_E	1.461	0.90
35_P	38_A	1.399	0.88
59_D	82_R	1.384	0.88
64_C	67_I	1.367	0.87
177_Q	181_D	1.345	0.86
37_V	66_V	1.313	0.85
24_N	48_E	1.312	0.85
41_I	86_I	1.290	0.84
80_K	165_G	1.269	0.83
28_S	33_G	1.243	0.81
26_I	63_A	1.218	0.80
43_E	180_R	1.190	0.78
160_L	164_I	1.181	0.78
176_Y	179_G	1.181	0.78
34_I	38_A	1.177	0.77
26_I	47_A	1.175	0.77
142_Y	148_I	1.174	0.77
14_P	75_C	1.171	0.77
162_A	173_A	1.152	0.76
36_P	112_E	1.142	0.75
148_I	151_Q	1.134	0.75
81_K	106_Y	1.121	0.74
26_I	64_C	1.114	0.73
11_W	49_A	1.098	0.72
4_I	112_E	1.055	0.69
62_I	77_V	1.051	0.69
40_K	112_E	1.048	0.69
22_E	61_E	1.046	0.69
33_G	73_L	1.036	0.68
11_W	51_D	1.035	0.68
142_Y	145_S	1.029	0.67
173_A	176_Y	1.022	0.67
146_K	149_T	1.021	0.67
87_N	92_G	1.008	0.66
121_S	128_A	0.999	0.65
41_I	115_I	0.995	0.65
125_A	128_A	0.985	0.64
158_K	162_A	0.983	0.64
147_K	150_E	0.974	0.63
29_V	65_A	0.969	0.63
59_D	83_I	0.959	0.62
13_G	75_C	0.953	0.61
40_K	115_I	0.951	0.61
83_I	105_I	0.951	0.61
4_I	64_C	0.949	0.61
28_S	49_A	0.947	0.61
80_K	100_F	0.947	0.61
80_K	182_T	0.934	0.60
38_A	49_A	0.931	0.59
93_K	102_T	0.921	0.59
28_S	39_D	0.919	0.58
122_E	127_A	0.917	0.58
2_V	47_A	0.914	0.58
24_N	47_A	0.908	0.58
11_W	33_G	0.908	0.58
27_V	61_E	0.906	0.57
25_K	81_K	0.903	0.57
62_I	65_A	0.891	0.56
86_I	89_T	0.887	0.56
2_V	26_I	0.885	0.56
6_K	9_G	0.885	0.56
11_W	102_T	0.880	0.55
54_K	115_I	0.878	0.55
34_I	51_D	0.870	0.54
170_K	182_T	0.870	0.54
14_P	87_N	0.869	0.54
59_D	65_A	0.868	0.54
29_V	73_L	0.859	0.53
38_A	42_A	0.856	0.53
133_E	136_A	0.854	0.53
129_A	133_E	0.849	0.52
126_A	132_A	0.849	0.52
163_K	183_I	0.849	0.52
7_G	10_G	0.848	0.52
169_G	180_R	0.848	0.52
113_E	128_A	0.848	0.52
168_M	182_T	0.844	0.52
178_A	181_D	0.843	0.52
68_D	176_Y	0.842	0.52
180_R	183_I	0.837	0.51
20_T	23_K	0.834	0.51
161_I	177_Q	0.814	0.49
179_G	182_T	0.812	0.49
143_D	146_K	0.808	0.49
62_I	83_I	0.803	0.48
56_S	59_D	0.802	0.48
13_G	87_N	0.800	0.48
63_A	66_V	0.796	0.48
49_A	52_G	0.796	0.48
118_A	122_E	0.790	0.47
3_K	118_A	0.780	0.46
33_G	77_V	0.779	0.46
130_A	133_E	0.777	0.46
178_A	182_T	0.777	0.46
43_E	48_E	0.771	0.46
112_E	115_I	0.768	0.45
36_P	63_A	0.768	0.45
29_V	51_D	0.763	0.45
120_G	141_K	0.763	0.45
131_A	139_E	0.756	0.44
28_S	38_A	0.755	0.44
35_P	88_I	0.754	0.44
170_K	174_T	0.752	0.44
27_V	42_A	0.751	0.44
81_K	92_G	0.746	0.44
75_C	106_Y	0.745	0.43
63_A	84_P	0.743	0.43
147_K	151_Q	0.740	0.43
166_R	172_V	0.739	0.43
75_C	92_G	0.738	0.43
66_V	86_I	0.738	0.43
165_G	172_V	0.733	0.42
28_S	36_P	0.732	0.42
99_Q	102_T	0.728	0.42
23_K	127_A	0.725	0.42
51_D	182_T	0.725	0.42
138_K	141_K	0.723	0.42
72_T	77_V	0.722	0.42
67_I	174_T	0.721	0.41
19_P	63_A	0.716	0.41
30_T	94_S	0.715	0.41
27_V	57_V	0.714	0.41
27_V	52_G	0.713	0.41
77_V	80_K	0.712	0.41
26_I	38_A	0.711	0.41
160_L	168_M	0.709	0.40
169_G	178_A	0.702	0.40
83_I	98_A	0.699	0.40
165_G	169_G	0.694	0.39
123_A	126_A	0.692	0.39
127_A	130_A	0.685	0.38
144_T	149_T	0.683	0.38
169_G	172_V	0.678	0.38
118_A	124_A	0.675	0.38
58_P	61_E	0.668	0.37
127_A	132_A	0.666	0.37
86_I	113_E	0.663	0.37
147_K	180_R	0.662	0.37
34_I	93_K	0.662	0.37
144_T	148_I	0.658	0.36
39_D	115_I	0.656	0.36
91_T	173_A	0.652	0.36
133_E	137_E	0.650	0.36
142_Y	146_K	0.649	0.36
142_Y	147_K	0.648	0.35
168_M	176_Y	0.641	0.35
145_S	149_T	0.637	0.35
68_D	89_T	0.636	0.35
20_T	63_A	0.634	0.34
167_G	171_V	0.633	0.34
113_E	122_E	0.629	0.34
30_T	109_G	0.617	0.33
168_M	179_G	0.617	0.33
8_S	114_N	0.611	0.33
2_V	18_T	0.610	0.33
92_G	98_A	0.605	0.32
65_A	168_M	0.604	0.32
7_G	12_G	0.602	0.32
101_I	105_I	0.602	0.32
125_A	133_E	0.602	0.32
125_A	132_A	0.601	0.32
99_Q	150_E	0.601	0.32
131_A	135_A	0.600	0.32
72_T	96_P	0.598	0.32
38_A	111_K	0.597	0.32
51_D	159_G	0.595	0.31
126_A	129_A	0.593	0.31
28_S	73_L	0.592	0.31
66_V	131_A	0.591	0.31
33_G	49_A	0.590	0.31
156_G	162_A	0.580	0.30
9_G	18_T	0.578	0.30
59_D	106_Y	0.577	0.30
161_I	171_V	0.575	0.30
24_N	81_K	0.575	0.30
16_V	20_T	0.573	0.30
47_A	57_V	0.572	0.30
19_P	98_A	0.570	0.30
84_P	104_D	0.567	0.29
158_K	166_R	0.567	0.29
68_D	166_R	0.567	0.29
64_C	86_I	0.566	0.29
118_A	171_V	0.563	0.29
169_G	175_F	0.563	0.29
131_A	138_K	0.560	0.29
87_N	93_K	0.560	0.29
176_Y	181_D	0.559	0.29
86_I	107_V	0.558	0.29
175_F	180_R	0.557	0.29
4_I	62_I	0.556	0.29
19_P	23_K	0.556	0.29
14_P	92_G	0.554	0.28
45_T	58_P	0.551	0.28
143_D	151_Q	0.550	0.28
141_K	144_T	0.549	0.28
29_V	37_V	0.549	0.28
2_V	64_C	0.548	0.28
54_K	90_P	0.548	0.28
91_T	106_Y	0.546	0.28
175_F	179_G	0.541	0.28
119_D	123_A	0.541	0.28
34_I	49_A	0.539	0.27
132_A	135_A	0.537	0.27
162_A	168_M	0.536	0.27
44_L	66_V	0.535	0.27
52_G	81_K	0.535	0.27
3_K	116_S	0.531	0.27
141_K	148_I	0.531	0.27
25_K	48_E	0.529	0.27
157_K	167_G	0.529	0.27
35_P	39_D	0.527	0.27
43_E	112_E	0.520	0.26
129_A	136_A	0.518	0.26
81_K	105_I	0.517	0.26
67_I	99_Q	0.517	0.26
164_I	169_G	0.513	0.26
118_A	123_A	0.512	0.26
109_G	114_N	0.511	0.25
24_N	57_V	0.511	0.25
77_V	101_I	0.511	0.25
172_V	175_F	0.508	0.25
81_K	98_A	0.507	0.25
68_D	178_A	0.507	0.25
176_Y	180_R	0.506	0.25
14_P	106_Y	0.503	0.25
30_T	88_I	0.503	0.25
30_T	51_D	0.502	0.25
16_V	119_D	0.501	0.25
11_W	73_L	0.500	0.25
123_A	131_A	0.500	0.25

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1um1A	1	0.4674	48.8	0.956	Contact Map
4h11A	2	0.4293	31.8	0.96	Contact Map
1uitA	1	0.4891	28	0.961	Contact Map
2dazA	1	0.4565	24.7	0.962	Contact Map
1um7A	1	0.4674	22.6	0.963	Contact Map
2csjA	1	0.4728	19.4	0.964	Contact Map
2i1nA	4	0.4293	17.6	0.965	Contact Map
2enoA	1	0.462	17.6	0.965	Contact Map
1uhpA	1	0.4293	15.9	0.965	Contact Map
2v90A	4	0.4293	14.6	0.966	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.