DUF1759 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1759 - Protein of unknown function (DUF1759)

PFAM:	PF03564	Sequences: FSGDPLEWPSFWDLFESLIHDNPSLSDVEKLHYLKSSLKGEALELIKGLPLTDENYEEAWELLKERYGNKRLIIQAHLKKLLNLPPIKKEDASSLRKLLDTLESHLRALEALGVPVDLWDPLLVHLILSKLPPETRREWERSVKDTKE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	148 (142)
Sequences:	4533 (3975)
Seq/√Len:	333.6
META:	0.678

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
12_W	60_W	3.577	1.00
27_D	57_E	3.365	1.00
20_H	56_Y	3.342	1.00
2_S	7_E	2.678	1.00
12_W	64_K	2.589	1.00
4_D	7_E	2.589	1.00
16_E	21_D	2.587	1.00
138_E	141_R	2.413	1.00
61_E	65_E	2.260	1.00
27_D	53_D	2.258	1.00
77_H	105_H	2.238	1.00
66_R	100_D	2.146	1.00
16_E	60_W	2.123	1.00
82_L	126_L	2.081	1.00
45_L	62_L	2.056	1.00
91_D	94_S	2.004	1.00
114_V	121_P	1.999	1.00
2_S	39_K	1.983	1.00
58_E	61_E	1.882	1.00
8_W	64_K	1.849	1.00
44_E	47_K	1.810	1.00
79_K	83_N	1.758	1.00
132_P	135_T	1.745	1.00
57_E	61_E	1.691	1.00
46_I	59_A	1.646	1.00
42_A	45_L	1.626	1.00
43_L	47_K	1.594	1.00
6_L	80_K	1.576	1.00
80_K	105_H	1.575	1.00
38_L	43_L	1.564	1.00
128_L	136_R	1.549	1.00
31_L	59_A	1.518	1.00
12_W	16_E	1.506	1.00
77_H	108_A	1.498	1.00
44_E	97_K	1.487	1.00
49_L	62_L	1.440	1.00
58_E	110_E	1.435	1.00
79_K	129_S	1.428	1.00
26_S	29_E	1.423	1.00
8_W	12_W	1.385	1.00
75_Q	125_H	1.375	1.00
80_K	101_T	1.360	1.00
16_E	20_H	1.352	1.00
11_F	37_S	1.345	1.00
41_E	67_Y	1.345	1.00
20_H	60_W	1.331	1.00
116_V	119_W	1.307	1.00
102_L	127_I	1.304	1.00
66_R	96_R	1.301	1.00
64_K	68_G	1.260	1.00
45_L	67_Y	1.260	1.00
49_L	58_E	1.242	1.00
7_E	47_K	1.242	1.00
134_E	137_R	1.234	1.00
38_L	46_I	1.209	1.00
35_K	43_L	1.206	1.00
28_V	53_D	1.194	1.00
27_D	30_K	1.191	1.00
10_S	35_K	1.174	1.00
82_L	125_H	1.157	1.00
6_L	76_A	1.130	1.00
97_K	101_T	1.121	1.00
84_L	130_K	1.115	1.00
128_L	139_W	1.094	1.00
42_A	67_Y	1.089	1.00
84_L	101_T	1.079	1.00
55_N	58_E	1.074	1.00
41_E	44_E	1.033	1.00
94_S	97_K	1.024	1.00
69_N	72_L	0.990	1.00
87_I	94_S	0.966	1.00
49_L	59_A	0.966	1.00
30_K	56_Y	0.958	1.00
79_K	125_H	0.932	1.00
83_N	129_S	0.927	1.00
44_E	101_T	0.925	1.00
18_L	32_H	0.919	1.00
44_E	104_S	0.914	1.00
74_I	114_V	0.904	1.00
106_L	123_L	0.899	1.00
56_Y	59_A	0.899	1.00
19_I	33_Y	0.891	1.00
25_L	33_Y	0.889	1.00
20_H	30_K	0.886	1.00
87_I	98_L	0.881	1.00
124_V	128_L	0.881	1.00
95_L	131_L	0.879	1.00
61_E	64_K	0.869	1.00
15_F	19_I	0.868	1.00
16_E	64_K	0.868	1.00
103_E	107_R	0.855	1.00
85_P	130_K	0.843	1.00
101_T	104_S	0.843	1.00
15_F	20_H	0.843	1.00
13_D	53_D	0.841	1.00
115_P	118_L	0.838	1.00
41_E	93_S	0.815	1.00
35_K	46_I	0.811	1.00
7_E	10_S	0.803	1.00
5_P	72_L	0.798	1.00
133_P	137_R	0.797	1.00
78_L	82_L	0.796	1.00
14_L	29_E	0.789	1.00
22_N	25_L	0.788	1.00
99_L	102_L	0.785	1.00
99_L	103_E	0.784	1.00
78_L	122_L	0.778	1.00
41_E	97_K	0.778	1.00
107_R	110_E	0.772	1.00
11_F	34_L	0.766	1.00
31_L	51_L	0.761	1.00
9_P	13_D	0.756	1.00
75_Q	128_L	0.744	0.99
14_L	35_K	0.743	0.99
122_L	126_L	0.739	0.99
77_H	80_K	0.737	0.99
56_Y	60_W	0.736	0.99
87_I	132_P	0.733	0.99
88_K	98_L	0.729	0.99
45_L	100_D	0.728	0.99
71_R	74_I	0.727	0.99
73_I	77_H	0.725	0.99
27_D	54_E	0.725	0.99
41_E	96_R	0.719	0.99
58_E	107_R	0.718	0.99
43_L	46_I	0.717	0.99
11_F	15_F	0.716	0.99
17_S	29_E	0.714	0.99
124_V	139_W	0.705	0.99
28_V	51_L	0.705	0.99
9_P	73_I	0.697	0.99
96_R	100_D	0.695	0.99
62_L	103_E	0.695	0.99
71_R	140_E	0.694	0.99
14_L	32_H	0.691	0.99
105_H	108_A	0.689	0.99
60_W	64_K	0.683	0.99
121_P	124_V	0.676	0.99
51_L	55_N	0.673	0.99
55_N	59_A	0.667	0.99
5_P	9_P	0.667	0.99
8_W	11_F	0.655	0.99
48_G	104_S	0.652	0.99
15_F	34_L	0.644	0.98
136_R	140_E	0.639	0.98
74_I	121_P	0.636	0.98
115_P	119_W	0.631	0.98
9_P	12_W	0.630	0.98
8_W	60_W	0.629	0.98
89_K	94_S	0.626	0.98
90_E	137_R	0.623	0.98
130_K	139_W	0.623	0.98
39_K	43_L	0.616	0.98
98_L	130_K	0.616	0.98
8_W	63_L	0.615	0.98
82_L	129_S	0.614	0.98
129_S	136_R	0.608	0.98
32_H	37_S	0.608	0.98
70_K	113_G	0.605	0.98
23_P	26_S	0.603	0.98
35_K	51_L	0.603	0.98
85_P	97_K	0.603	0.98
109_L	117_D	0.603	0.98
84_L	102_L	0.601	0.98
78_L	125_H	0.599	0.98
98_L	131_L	0.593	0.97
81_L	105_H	0.592	0.97
32_H	51_L	0.589	0.97
76_A	80_K	0.589	0.97
110_E	115_P	0.589	0.97
13_D	17_S	0.589	0.97
78_L	109_L	0.581	0.97
84_L	98_L	0.578	0.97
73_I	76_A	0.575	0.97
33_Y	36_S	0.575	0.97
133_P	136_R	0.575	0.97
98_L	102_L	0.574	0.97
134_E	141_R	0.573	0.97
98_L	127_I	0.573	0.97
10_S	47_K	0.571	0.97
84_L	127_I	0.569	0.97
90_E	134_E	0.567	0.97
124_V	136_R	0.566	0.97
95_L	135_T	0.563	0.96
80_K	104_S	0.556	0.96
21_D	24_S	0.555	0.96
26_S	53_D	0.553	0.96
33_Y	37_S	0.551	0.96
15_F	31_L	0.551	0.96
75_Q	78_L	0.547	0.96
25_L	30_K	0.547	0.96
89_K	133_P	0.545	0.96
8_W	18_L	0.545	0.96
44_E	100_D	0.541	0.96
87_I	90_E	0.540	0.96
131_L	139_W	0.536	0.95
14_L	18_L	0.535	0.95
35_K	38_L	0.535	0.95
1_F	67_Y	0.533	0.95
52_T	55_N	0.533	0.95
17_S	33_Y	0.529	0.95
93_S	97_K	0.526	0.95
137_R	140_E	0.522	0.95
135_T	140_E	0.521	0.95
5_P	68_G	0.516	0.94
45_L	48_G	0.516	0.94
11_F	55_N	0.515	0.94
73_I	111_A	0.511	0.94
21_D	30_K	0.508	0.94
106_L	110_E	0.505	0.94
115_P	121_P	0.501	0.93
28_V	31_L	0.501	0.93
20_H	23_P	0.500	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4m7cA	2	0.8243	16.5	0.904	Contact Map
3bqoA	2	0.8581	15	0.907	Contact Map
1txdA	1	0.8311	14.9	0.907	Contact Map
1rcdA	6	0.8378	12.1	0.91	Contact Map
1vlgA	6	0.8243	11.5	0.911	Contact Map
3sylA	2	0.7095	9.4	0.915	Contact Map
4fkeA	1	0.9527	8.3	0.917	Contact Map
2v2pA	6	0.8311	8	0.917	Contact Map
1f75A	2	0.2905	8	0.917	Contact Map
4q9mA	2	0.2973	7.7	0.918	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.