Peptidase_S77 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Peptidase_S77 - Prohead core protein serine protease

PFAM:	PF03420	Sequences: LLIEHWGQPGEIIDVKYLVEEEEGKDFGGKKNLYIEGIFQQAEVKNRNGRVYPKEILEREVKRYNKEFIKENRALGELDHPDGPTINLDRVSHMITELWWDGNNVIGKAKILDTPMGKGKIVKSLLESGVKLGVSSRGMGSLKESNGGVNEVQDDFELAIAFDIVADPSAPGAFVNGKEIMESKT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	185 (148)
Sequences:	4922 (2117)
Seq/√Len:	174.0
META:	0.988

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
43_E	103_N	2.863	1.00
138_G	156_F	2.660	1.00
54_K	58_E	2.504	1.00
75_L	130_V	2.473	1.00
170_A	173_A	2.458	1.00
122_V	164_I	2.398	1.00
36_E	108_K	2.358	1.00
120_K	123_K	2.302	1.00
60_E	63_R	2.150	1.00
100_W	105_V	2.114	1.00
143_K	153_Q	2.081	1.00
45_K	49_G	1.963	1.00
45_K	149_V	1.959	1.00
58_E	100_W	1.956	1.00
42_A	54_K	1.948	1.00
54_K	103_N	1.873	1.00
113_D	128_S	1.863	1.00
125_L	130_V	1.855	1.00
97_E	108_K	1.846	1.00
54_K	100_W	1.760	1.00
71_E	131_K	1.741	1.00
32_N	110_K	1.708	1.00
141_S	155_D	1.673	1.00
40_Q	136_S	1.667	1.00
41_Q	104_N	1.661	1.00
66_K	70_K	1.660	1.00
94_M	110_K	1.630	1.00
111_I	122_V	1.629	1.00
89_D	116_M	1.620	1.00
94_M	130_V	1.604	1.00
43_E	54_K	1.601	1.00
42_A	57_L	1.546	1.00
145_S	151_E	1.544	1.00
44_V	171_P	1.526	1.00
144_E	150_N	1.524	1.00
88_L	166_A	1.523	1.00
38_I	41_Q	1.512	1.00
34_Y	108_K	1.498	1.00
65_N	69_I	1.488	1.00
45_K	51_V	1.483	1.00
99_W	106_I	1.478	1.00
72_N	96_T	1.469	1.00
41_Q	44_V	1.452	1.00
115_P	121_I	1.440	1.00
72_N	94_M	1.405	1.00
113_D	123_K	1.388	1.00
39_F	109_A	1.375	1.00
63_R	67_E	1.351	1.00
123_K	127_E	1.327	1.00
33_L	127_E	1.321	1.00
124_S	127_E	1.320	1.00
113_D	120_K	1.319	1.00
58_E	62_K	1.318	1.00
109_A	164_I	1.312	1.00
101_D	104_N	1.293	1.00
65_N	68_F	1.288	1.00
79_D	87_N	1.255	1.00
41_Q	172_G	1.230	1.00
96_T	110_K	1.226	1.00
144_E	147_G	1.222	1.00
67_E	71_E	1.216	1.00
64_Y	74_A	1.202	1.00
39_F	107_G	1.195	1.00
53_P	56_I	1.177	1.00
75_L	91_V	1.173	1.00
142_L	150_N	1.172	1.00
78_L	122_V	1.161	1.00
65_N	70_K	1.155	1.00
62_K	66_K	1.140	1.00
64_Y	161_A	1.130	1.00
76_G	93_H	1.107	1.00
112_L	128_S	1.102	1.00
61_V	105_V	1.101	1.00
59_R	154_D	1.096	1.00
38_I	104_N	1.082	1.00
77_E	90_R	1.077	1.00
124_S	128_S	1.076	1.00
141_S	153_Q	1.074	1.00
39_F	95_I	1.050	1.00
65_N	97_E	1.045	0.99
55_E	58_E	1.019	0.99
90_R	116_M	1.019	0.99
96_T	108_K	1.001	0.99
72_N	129_G	0.993	0.99
39_F	98_L	0.982	0.99
46_N	169_S	0.980	0.99
59_R	62_K	0.942	0.99
134_V	164_I	0.937	0.99
110_K	128_S	0.933	0.99
145_S	149_V	0.932	0.99
47_R	167_D	0.925	0.99
40_Q	105_V	0.922	0.99
113_D	124_S	0.915	0.99
40_Q	57_L	0.913	0.99
51_V	151_E	0.905	0.99
61_V	98_L	0.895	0.98
69_I	74_A	0.892	0.98
39_F	134_V	0.889	0.98
35_I	109_A	0.889	0.98
112_L	130_V	0.877	0.98
54_K	105_V	0.876	0.98
44_V	172_G	0.874	0.98
84_P	139_M	0.865	0.98
53_P	151_E	0.852	0.98
88_L	132_L	0.850	0.98
143_K	151_E	0.847	0.98
70_K	97_E	0.838	0.98
42_A	100_W	0.835	0.98
33_L	123_K	0.833	0.97
41_Q	170_A	0.812	0.97
75_L	125_L	0.808	0.97
66_K	69_I	0.806	0.97
35_I	164_I	0.805	0.97
36_E	99_W	0.803	0.97
26_D	31_K	0.802	0.97
131_K	176_N	0.797	0.97
81_P	137_R	0.797	0.97
136_S	162_F	0.790	0.97
120_K	124_S	0.775	0.96
88_L	91_V	0.774	0.96
75_L	94_M	0.774	0.96
33_L	126_L	0.773	0.96
59_R	63_R	0.760	0.96
134_V	162_F	0.757	0.96
40_Q	162_F	0.751	0.95
77_E	81_P	0.750	0.95
72_N	110_K	0.747	0.95
40_Q	170_A	0.744	0.95
57_L	105_V	0.730	0.95
35_I	126_L	0.726	0.94
43_E	53_P	0.720	0.94
38_I	106_I	0.719	0.94
99_W	108_K	0.711	0.94
25_K	30_K	0.709	0.94
83_G	87_N	0.708	0.94
63_R	157_E	0.707	0.94
92_S	164_I	0.702	0.93
113_D	127_E	0.694	0.93
66_K	71_E	0.691	0.93
134_V	175_V	0.683	0.93
43_E	55_E	0.680	0.92
44_V	103_N	0.679	0.92
114_T	121_I	0.673	0.92
114_T	128_S	0.669	0.92
26_D	30_K	0.666	0.92
151_E	154_D	0.658	0.91
25_K	31_K	0.657	0.91
101_D	106_I	0.656	0.91
68_F	73_R	0.651	0.91
112_L	124_S	0.650	0.91
77_E	87_N	0.649	0.90
41_Q	171_P	0.649	0.90
114_T	120_K	0.649	0.90
49_G	149_V	0.642	0.90
33_L	111_I	0.636	0.90
104_N	172_G	0.636	0.90
116_M	121_I	0.634	0.89
116_M	124_S	0.634	0.89
74_A	161_A	0.632	0.89
94_M	112_L	0.626	0.89
56_I	60_E	0.624	0.89
162_F	175_V	0.621	0.88
34_Y	96_T	0.620	0.88
68_F	71_E	0.620	0.88
114_T	123_K	0.619	0.88
56_I	59_R	0.617	0.88
150_N	153_Q	0.614	0.88
111_I	164_I	0.612	0.88
58_E	105_V	0.610	0.88
97_E	101_D	0.604	0.87
47_R	171_P	0.602	0.87
62_K	65_N	0.602	0.87
174_F	177_G	0.601	0.87
86_I	161_A	0.598	0.87
36_E	97_E	0.592	0.86
34_Y	110_K	0.591	0.86
95_I	109_A	0.589	0.86
40_Q	61_V	0.588	0.86
121_I	124_S	0.584	0.85
115_P	124_S	0.583	0.85
132_L	164_I	0.579	0.85
95_I	161_A	0.577	0.85
59_R	155_D	0.569	0.84
109_A	132_L	0.569	0.84
30_K	127_E	0.569	0.84
24_G	31_K	0.568	0.84
72_N	131_K	0.561	0.83
63_R	66_K	0.559	0.83
73_R	131_K	0.558	0.83
55_E	154_D	0.554	0.82
64_Y	69_I	0.551	0.82
120_K	128_S	0.551	0.82
78_L	121_I	0.549	0.82
57_L	100_W	0.549	0.82
91_V	166_A	0.548	0.81
79_D	88_L	0.547	0.81
121_I	125_L	0.546	0.81
126_L	132_L	0.545	0.81
58_E	61_V	0.545	0.81
95_I	162_F	0.544	0.81
37_G	175_V	0.543	0.81
164_I	175_V	0.542	0.81
133_G	169_S	0.541	0.81
83_G	89_D	0.538	0.80
51_V	149_V	0.537	0.80
93_H	164_I	0.537	0.80
73_R	167_D	0.531	0.79
46_N	50_R	0.526	0.79
24_G	32_N	0.520	0.78
95_I	134_V	0.517	0.78
42_A	105_V	0.516	0.77
61_V	136_S	0.516	0.77
56_I	154_D	0.515	0.77
136_S	170_A	0.515	0.77
116_M	122_V	0.513	0.77
122_V	132_L	0.511	0.77
24_G	30_K	0.510	0.77
109_A	134_V	0.508	0.76
134_V	170_A	0.506	0.76
92_S	122_V	0.503	0.76
162_F	170_A	0.501	0.75
114_T	124_S	0.500	0.75

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3v2hA	4	0.427	5.2	0.96	Contact Map
2ek0A	3	0.4162	3.3	0.964	Contact Map
4bnwA	4	0.5027	3.3	0.964	Contact Map
3kojA	3	0.2486	3.1	0.964	Contact Map
1qx2A	2	0.373	2.8	0.965	Contact Map
3h38A	1	0.3189	2.7	0.966	Contact Map
4c31C	2	0.0811	2.5	0.966	Contact Map
2mhhA	1	0.5081	2.5	0.966	Contact Map
1wwhA	3	0.3243	2.4	0.966	Contact Map
2ns1B	3	0.4216	2.1	0.967	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.