ANT - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ANT - Phage antirepressor protein KilAC domain

PFAM:	PF03374	Sequences: EQQIEELKPKAEFADAVLASKGSILITEIAKDLGIGANRLFKWLRENGILYKRKGGGRNLPYQKYIDKGYFEVKETTITHSDGSTKITTTTKVTGKGRLFLYNLLKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	107 (103)
Sequences:	7127 (5591)
Seq/√Len:	550.9
META:	0.799

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
7_L	11_A	3.579	1.00
4_I	7_L	3.390	1.00
43_W	47_N	2.876	1.00
10_K	15_D	2.549	1.00
3_Q	7_L	2.508	1.00
45_R	59_N	2.319	1.00
70_Y	100_F	2.121	1.00
80_H	86_K	2.096	1.00
26_I	41_F	2.036	1.00
23_S	92_K	2.029	1.00
23_S	72_E	1.991	1.00
27_T	37_A	1.917	1.00
36_G	39_R	1.759	1.00
35_I	39_R	1.688	1.00
29_I	98_R	1.676	1.00
74_K	92_K	1.620	1.00
25_L	28_E	1.566	1.00
8_K	12_E	1.550	1.00
65_Y	70_Y	1.480	1.00
80_H	84_S	1.461	1.00
78_I	88_T	1.418	1.00
63_Q	66_I	1.416	1.00
64_K	68_K	1.378	1.00
42_K	46_E	1.369	1.00
47_N	105_L	1.369	1.00
49_I	100_F	1.346	1.00
71_F	91_T	1.300	1.00
28_E	60_L	1.289	1.00
76_T	88_T	1.275	1.00
3_Q	8_K	1.268	1.00
25_L	90_T	1.264	1.00
100_F	104_L	1.252	1.00
62_Y	65_Y	1.249	1.00
13_F	17_V	1.245	1.00
5_E	8_K	1.237	1.00
29_I	93_V	1.231	1.00
78_I	86_K	1.217	1.00
10_K	14_A	1.198	1.00
37_A	41_F	1.196	1.00
77_T	85_T	1.179	1.00
71_F	93_V	1.169	1.00
99_L	103_N	1.167	1.00
24_I	29_I	1.119	1.00
51_Y	62_Y	1.111	1.00
49_I	101_L	1.077	1.00
99_L	102_Y	1.077	1.00
26_I	93_V	1.072	1.00
48_G	62_Y	1.063	1.00
26_I	37_A	1.027	1.00
17_V	95_G	1.023	1.00
31_K	51_Y	0.994	1.00
30_A	40_L	0.986	1.00
49_I	65_Y	0.980	1.00
75_E	87_I	0.975	1.00
31_K	63_Q	0.972	1.00
61_P	71_F	0.965	1.00
23_S	94_T	0.960	1.00
41_F	50_L	0.959	1.00
11_A	15_D	0.955	1.00
3_Q	6_E	0.951	1.00
32_D	98_R	0.943	1.00
47_N	104_L	0.939	1.00
75_E	89_T	0.938	1.00
79_T	85_T	0.938	1.00
50_L	59_N	0.923	1.00
102_Y	106_K	0.914	1.00
6_E	11_A	0.904	1.00
43_W	105_L	0.900	1.00
27_T	31_K	0.896	1.00
51_Y	60_L	0.890	1.00
50_L	91_T	0.876	1.00
15_D	18_L	0.871	1.00
31_K	66_I	0.869	1.00
51_Y	57_G	0.835	1.00
65_Y	68_K	0.833	1.00
29_I	40_L	0.827	1.00
11_A	14_A	0.826	1.00
60_L	73_V	0.814	1.00
41_F	59_N	0.803	1.00
7_L	10_K	0.802	1.00
76_T	90_T	0.802	1.00
61_P	73_V	0.798	1.00
29_I	101_L	0.796	1.00
77_T	87_I	0.793	1.00
52_K	59_N	0.787	1.00
73_V	89_T	0.786	1.00
44_L	101_L	0.781	1.00
12_E	16_A	0.776	1.00
49_I	104_L	0.760	1.00
27_T	51_Y	0.756	1.00
53_R	60_L	0.754	1.00
25_L	92_K	0.747	1.00
35_I	43_W	0.745	1.00
2_Q	5_E	0.741	1.00
38_N	42_K	0.740	1.00
39_R	42_K	0.735	1.00
13_F	18_L	0.735	1.00
81_S	84_S	0.731	1.00
14_A	18_L	0.728	1.00
36_G	63_Q	0.712	1.00
27_T	60_L	0.710	1.00
24_I	98_R	0.709	1.00
28_E	89_T	0.706	1.00
41_F	45_R	0.704	1.00
14_A	99_L	0.701	1.00
22_G	87_I	0.687	1.00
24_I	32_D	0.678	1.00
39_R	67_D	0.677	1.00
48_G	64_K	0.675	1.00
32_D	75_E	0.671	1.00
26_I	50_L	0.669	1.00
20_S	87_I	0.660	1.00
75_E	98_R	0.659	1.00
76_T	86_K	0.658	1.00
93_V	101_L	0.657	1.00
53_R	56_G	0.656	1.00
28_E	58_R	0.655	1.00
4_I	8_K	0.654	1.00
40_L	101_L	0.649	1.00
43_W	46_E	0.646	1.00
2_Q	6_E	0.646	1.00
65_Y	71_F	0.646	1.00
13_F	99_L	0.625	1.00
24_I	89_T	0.620	1.00
43_W	104_L	0.619	1.00
16_A	102_Y	0.612	1.00
18_L	99_L	0.602	1.00
93_V	100_F	0.601	1.00
26_I	40_L	0.601	1.00
73_V	91_T	0.596	1.00
56_G	92_K	0.594	1.00
63_Q	67_D	0.593	1.00
33_L	102_Y	0.589	1.00
100_F	103_N	0.584	1.00
35_I	40_L	0.583	1.00
31_K	60_L	0.580	0.99
23_S	95_G	0.580	0.99
14_A	17_V	0.575	0.99
8_K	11_A	0.562	0.99
79_T	82_D	0.552	0.99
42_K	45_R	0.548	0.99
53_R	58_R	0.548	0.99
16_A	77_T	0.540	0.99
39_R	43_W	0.539	0.99
12_E	15_D	0.526	0.99
69_G	96_K	0.523	0.99
45_R	62_Y	0.523	0.99
45_R	52_K	0.514	0.99
61_P	66_I	0.511	0.99
25_L	37_A	0.509	0.99
4_I	11_A	0.509	0.99
35_I	105_L	0.509	0.99
61_P	93_V	0.508	0.99
13_F	98_R	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4l5eA	2	0.4299	67.3	0.826	Contact Map
3r4kA	2	0.9813	64.8	0.829	Contact Map
1y6uA	1	0.5421	61.7	0.833	Contact Map
4ou0A	1	0.5514	60.9	0.834	Contact Map
1on2A	2	0.8879	59.2	0.835	Contact Map
4j2nA	4	0.5234	58.9	0.835	Contact Map
3nqoA	2	0.9439	58.7	0.836	Contact Map
2nyxA	2	0.9346	58.4	0.836	Contact Map
2og0A	1	0.4299	57.8	0.836	Contact Map
2pg4A	3	0.729	57.8	0.836	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.