UPF0114 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

UPF0114 - Uncharacterized protein family, UPF0114

PFAM:	PF03350	Sequences: LFASRWLLAPAYLGLLLALLALFVKFFVELVHLVPHVFTHALEEDLILGVLGLIDLFLIANLLLIVIFGGYELFVSKIDLAEHPDRPEWLGIVDLSDLKLKLAGSIVAISAIHLLKAF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	118 (117)
Sequences:	8062 (4290)
Seq/√Len:	396.6
META:	0.895

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
25_K	28_V	3.141	1.00
31_V	35_P	2.942	1.00
18_A	50_V	2.935	1.00
14_G	26_F	2.873	1.00
35_P	38_F	2.396	1.00
113_H	116_K	2.392	1.00
11_A	57_F	2.388	1.00
61_N	70_G	2.348	1.00
29_E	32_H	2.260	1.00
24_V	38_F	2.256	1.00
14_G	30_L	2.177	1.00
21_A	34_V	2.065	1.00
17_L	30_L	2.057	1.00
24_V	28_V	2.051	1.00
16_L	67_I	2.036	1.00
33_L	49_G	2.029	1.00
11_A	23_F	2.003	1.00
32_H	35_P	2.000	1.00
103_A	108_A	1.957	1.00
36_H	39_T	1.955	1.00
103_A	111_A	1.953	1.00
21_A	37_V	1.795	1.00
52_G	116_K	1.727	1.00
42_L	45_D	1.707	1.00
35_P	39_T	1.672	1.00
59_I	109_I	1.627	1.00
22_L	56_L	1.545	1.00
32_H	36_H	1.520	1.00
27_F	57_F	1.509	1.00
113_H	117_A	1.499	1.00
26_F	53_L	1.497	1.00
54_I	63_L	1.428	1.00
41_A	44_E	1.427	1.00
27_F	31_V	1.419	1.00
25_K	29_E	1.356	1.00
62_L	105_S	1.319	1.00
4_S	16_L	1.309	1.00
80_L	83_H	1.304	1.00
80_L	86_R	1.278	1.00
1_L	16_L	1.273	1.00
7_L	20_L	1.266	1.00
64_L	68_F	1.222	1.00
28_V	32_H	1.220	1.00
23_F	60_A	1.206	1.00
76_S	79_D	1.196	1.00
8_L	70_G	1.175	1.00
24_V	37_V	1.174	1.00
30_L	53_L	1.149	1.00
94_D	97_D	1.133	1.00
81_A	84_P	1.114	1.00
55_D	99_K	1.109	1.00
17_L	34_V	1.106	1.00
71_Y	75_V	1.049	1.00
107_V	111_A	1.048	1.00
22_L	50_V	1.048	1.00
104_G	108_A	1.020	1.00
80_L	84_P	1.003	1.00
51_L	115_L	1.001	1.00
50_V	63_L	0.981	1.00
69_G	92_I	0.978	1.00
61_N	105_S	0.954	1.00
26_F	57_F	0.934	1.00
111_A	115_L	0.924	1.00
96_S	104_G	0.915	1.00
10_P	27_F	0.909	1.00
41_A	46_L	0.905	1.00
62_L	112_I	0.895	1.00
71_Y	76_S	0.892	1.00
101_K	104_G	0.887	1.00
72_E	78_I	0.874	1.00
36_H	41_A	0.849	1.00
109_I	116_K	0.847	1.00
96_S	103_A	0.846	1.00
28_V	38_F	0.842	1.00
14_G	27_F	0.839	1.00
25_K	46_L	0.835	1.00
57_F	72_E	0.833	1.00
86_R	90_L	0.829	1.00
6_W	10_P	0.827	1.00
4_S	7_L	0.827	1.00
101_K	107_V	0.825	1.00
48_L	52_G	0.803	1.00
77_K	82_E	0.795	1.00
28_V	31_V	0.791	1.00
8_L	11_A	0.787	1.00
7_L	10_P	0.786	1.00
18_A	53_L	0.756	1.00
21_A	30_L	0.750	1.00
19_L	23_F	0.744	1.00
57_F	61_N	0.743	1.00
54_I	112_I	0.741	1.00
87_P	90_L	0.735	1.00
96_S	100_L	0.729	1.00
100_L	104_G	0.729	1.00
58_L	102_L	0.724	1.00
17_L	21_A	0.723	1.00
7_L	19_L	0.723	1.00
20_L	24_V	0.722	1.00
34_V	38_F	0.721	1.00
69_G	73_L	0.714	1.00
23_F	27_F	0.713	1.00
9_A	75_V	0.709	1.00
45_D	49_G	0.706	1.00
39_T	42_L	0.703	1.00
65_I	95_L	0.702	1.00
64_L	67_I	0.700	1.00
77_K	85_D	0.698	1.00
111_A	117_A	0.697	1.00
38_F	83_H	0.691	1.00
39_T	43_E	0.685	0.99
89_W	94_D	0.674	0.99
18_A	57_F	0.671	0.99
103_A	109_I	0.660	0.99
18_A	22_L	0.660	0.99
8_L	61_N	0.659	0.99
15_L	66_V	0.656	0.99
108_A	111_A	0.647	0.99
3_A	80_L	0.646	0.99
79_D	82_E	0.642	0.99
87_P	91_G	0.634	0.99
21_A	50_V	0.631	0.99
95_L	103_A	0.629	0.99
15_L	54_I	0.628	0.99
17_L	20_L	0.626	0.99
93_V	97_D	0.625	0.99
38_F	41_A	0.620	0.99
35_P	43_E	0.618	0.99
83_H	88_E	0.616	0.99
107_V	110_S	0.611	0.99
15_L	18_A	0.609	0.99
35_P	49_G	0.609	0.99
102_L	107_V	0.603	0.99
25_K	37_V	0.602	0.99
97_D	103_A	0.597	0.99
69_G	90_L	0.596	0.99
8_L	23_F	0.596	0.99
41_A	45_D	0.594	0.99
110_S	114_L	0.591	0.98
9_A	23_F	0.590	0.98
53_L	62_L	0.589	0.98
85_D	88_E	0.576	0.98
104_G	113_H	0.575	0.98
14_G	57_F	0.575	0.98
14_G	66_V	0.572	0.98
72_E	101_K	0.571	0.98
29_E	36_H	0.567	0.98
33_L	36_H	0.545	0.97
100_L	114_L	0.542	0.97
106_I	111_A	0.540	0.97
35_P	44_E	0.540	0.97
12_Y	70_G	0.539	0.97
95_L	111_A	0.538	0.97
40_H	45_D	0.537	0.97
16_L	20_L	0.535	0.97
34_V	49_G	0.535	0.97
74_F	106_I	0.535	0.97
39_T	83_H	0.535	0.97
77_K	91_G	0.533	0.97
22_L	59_I	0.532	0.97
59_I	62_L	0.532	0.97
82_E	85_D	0.531	0.97
16_L	88_E	0.531	0.97
36_H	45_D	0.525	0.97
69_G	98_L	0.522	0.97
51_L	112_I	0.521	0.97
81_A	88_E	0.517	0.97
9_A	71_Y	0.512	0.96
55_D	106_I	0.510	0.96
66_V	102_L	0.505	0.96
33_L	50_V	0.505	0.96
97_D	106_I	0.504	0.96
12_Y	19_L	0.502	0.96
99_K	104_G	0.502	0.96
15_L	53_L	0.501	0.96
63_L	67_I	0.500	0.96
105_S	110_S	0.500	0.96

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4q2eA	2	0.178	9.2	0.902	Contact Map
4hfiA	3	0.9322	6.7	0.908	Contact Map
3rqwA	4	0.8814	3.9	0.918	Contact Map
4pirA	3	0.822	3.3	0.921	Contact Map
4p6vB	1	0.3051	2.6	0.925	Contact Map
1rh5A	1	0.3475	2.5	0.926	Contact Map
4aq5A	1	0.6949	2.4	0.927	Contact Map
4aq5B	1	0.6949	2.3	0.927	Contact Map
3qnqA	2	0.7627	2.3	0.927	Contact Map
4aq5C	1	0.6949	2.3	0.928	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.