Cornichon - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Cornichon - Cornichon protein

PFAM:	PF03311	Sequences: AFLWLLALLLNAALLFLAVYFLICLSDLECDYINPIDLCNRLNPLVLPEYILHGFLTLLFLLTGHWFMFLLNLPLLAYNVYKYMSKQHLYDPTEIFNTLNKHKKERFIKLGFYLLLFFYYLY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	122 (121)
Sequences:	627 (412)
Seq/√Len:	37.5
META:	0.212

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
58_L	62_L	3.534	1.00
72_N	120_Y	2.971	1.00
28_L	31_D	2.692	1.00
81_Y	85_S	2.681	1.00
82_K	105_E	2.611	1.00
31_D	34_N	2.510	1.00
19_V	118_F	2.497	1.00
14_L	18_A	2.362	1.00
49_E	109_K	2.163	0.99
117_F	122_Y	2.150	0.99
27_D	38_L	2.106	0.99
39_C	90_Y	2.051	0.99
96_F	103_K	2.048	0.99
35_P	96_F	1.976	0.98
43_N	93_T	1.955	0.98
14_L	25_L	1.866	0.98
79_N	113_Y	1.862	0.98
29_E	103_K	1.823	0.97
15_L	19_V	1.736	0.97
51_I	54_G	1.718	0.96
54_G	76_L	1.685	0.96
7_A	60_F	1.637	0.95
31_D	35_P	1.617	0.95
53_H	72_N	1.610	0.95
105_E	109_K	1.592	0.94
94_E	97_N	1.583	0.94
73_L	77_A	1.580	0.94
16_F	19_V	1.570	0.94
32_Y	99_L	1.486	0.92
29_E	94_E	1.475	0.92
24_C	38_L	1.461	0.91
55_F	58_L	1.455	0.91
46_V	90_Y	1.442	0.91
75_L	79_N	1.431	0.90
28_L	34_N	1.328	0.87
79_N	109_K	1.313	0.86
48_P	74_P	1.312	0.86
67_F	115_L	1.306	0.86
92_P	96_F	1.301	0.86
23_I	52_L	1.299	0.85
27_D	33_I	1.270	0.84
5_L	9_L	1.251	0.83
46_V	75_L	1.248	0.83
26_S	29_E	1.240	0.83
47_L	53_H	1.217	0.81
12_A	122_Y	1.217	0.81
8_L	22_L	1.181	0.79
114_L	121_L	1.170	0.79
62_L	114_L	1.149	0.78
31_D	37_D	1.137	0.77
80_V	84_M	1.137	0.77
34_N	43_N	1.114	0.75
13_A	66_W	1.101	0.74
14_L	22_L	1.088	0.74
7_A	13_A	1.074	0.73
57_T	69_F	1.071	0.72
49_E	82_K	1.067	0.72
17_L	52_L	1.065	0.72
51_I	55_F	1.039	0.70
25_L	38_L	1.034	0.70
53_H	63_T	1.001	0.67
77_A	81_Y	0.992	0.66
105_E	108_I	0.989	0.66
31_D	96_F	0.974	0.65
105_E	112_F	0.955	0.63
68_M	119_Y	0.954	0.63
117_F	121_L	0.952	0.63
22_L	115_L	0.948	0.63
78_Y	81_Y	0.946	0.63
104_K	108_I	0.943	0.62
31_D	66_W	0.923	0.61
72_N	75_L	0.922	0.61
54_G	77_A	0.920	0.60
72_N	112_F	0.913	0.60
95_I	99_L	0.895	0.58
7_A	17_L	0.891	0.58
78_Y	89_L	0.888	0.58
16_F	21_F	0.879	0.57
86_K	100_N	0.871	0.56
21_F	92_P	0.870	0.56
48_P	66_W	0.867	0.56
5_L	37_D	0.863	0.56
5_L	11_N	0.834	0.53
6_L	13_A	0.829	0.53
104_K	111_G	0.818	0.52
65_H	68_M	0.813	0.51
70_L	81_Y	0.806	0.51
117_F	120_Y	0.801	0.50
42_L	90_Y	0.776	0.48
79_N	112_F	0.771	0.47
69_F	112_F	0.769	0.47
40_N	44_P	0.769	0.47
16_F	86_K	0.769	0.47
11_N	18_A	0.768	0.47
4_W	119_Y	0.765	0.47
26_S	91_D	0.763	0.47
64_G	67_F	0.760	0.46
19_V	23_I	0.755	0.46
79_N	105_E	0.753	0.46
105_E	114_L	0.749	0.45
49_E	78_Y	0.747	0.45
114_L	118_F	0.742	0.45
37_D	103_K	0.741	0.45
67_F	75_L	0.738	0.45
37_D	40_N	0.738	0.45
39_C	92_P	0.735	0.44
4_W	8_L	0.735	0.44
24_C	45_L	0.733	0.44
61_L	77_A	0.732	0.44
33_I	41_R	0.732	0.44
35_P	100_N	0.728	0.44
28_L	48_P	0.721	0.43
97_N	112_F	0.717	0.43
51_I	80_V	0.717	0.43
11_N	14_L	0.714	0.42
50_Y	78_Y	0.693	0.41
34_N	99_L	0.687	0.40
2_F	12_A	0.683	0.40
22_L	63_T	0.672	0.39
21_F	27_D	0.670	0.39
12_A	20_Y	0.669	0.39
102_H	106_R	0.656	0.37
67_F	116_L	0.654	0.37
111_G	116_L	0.650	0.37
16_F	23_I	0.649	0.37
71_L	121_L	0.644	0.36
11_N	52_L	0.641	0.36
60_F	76_L	0.638	0.36
5_L	50_Y	0.638	0.36
118_F	121_L	0.631	0.35
84_M	87_Q	0.625	0.35
23_I	113_Y	0.625	0.35
103_K	107_F	0.619	0.34
88_H	103_K	0.615	0.34
8_L	12_A	0.610	0.34
51_I	70_L	0.608	0.34
32_Y	95_I	0.605	0.33
3_L	7_A	0.605	0.33
4_W	88_H	0.602	0.33
17_L	39_C	0.593	0.32
59_L	65_H	0.593	0.32
11_N	97_N	0.588	0.32
52_L	78_Y	0.586	0.32
2_F	58_L	0.581	0.31
94_E	103_K	0.581	0.31
58_L	67_F	0.572	0.31
10_L	13_A	0.571	0.31
34_N	94_E	0.568	0.30
97_N	103_K	0.567	0.30
54_G	57_T	0.566	0.30
54_G	106_R	0.566	0.30
69_F	116_L	0.561	0.30
116_L	119_Y	0.561	0.30
76_L	81_Y	0.560	0.30
100_N	104_K	0.557	0.30
2_F	9_L	0.556	0.30
3_L	11_N	0.554	0.29
6_L	12_A	0.553	0.29
5_L	75_L	0.550	0.29
81_Y	114_L	0.549	0.29
73_L	116_L	0.548	0.29
73_L	76_L	0.547	0.29
114_L	122_Y	0.546	0.29
28_L	91_D	0.544	0.29
18_A	58_L	0.542	0.29
70_L	108_I	0.541	0.28
20_Y	26_S	0.540	0.28
61_L	67_F	0.536	0.28
61_L	64_G	0.536	0.28
51_I	115_L	0.532	0.28
2_F	10_L	0.527	0.27
32_Y	40_N	0.526	0.27
11_N	92_P	0.524	0.27
96_F	100_N	0.524	0.27
16_F	121_L	0.518	0.27
52_L	73_L	0.518	0.27
37_D	49_E	0.517	0.27
51_I	58_L	0.516	0.27
56_L	60_F	0.515	0.27
71_L	80_V	0.514	0.27
99_L	104_K	0.508	0.26
45_L	108_I	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2z73A	2	0.8934	5.2	0.927	Contact Map
4mbsA	1	0.9016	4.4	0.929	Contact Map
4eiyA	1	0.9098	3.7	0.932	Contact Map
2ks9A	1	0.8689	3.5	0.933	Contact Map
4xnvA	1	0.8852	3.5	0.933	Contact Map
4yayA	1	0.7049	3.3	0.934	Contact Map
4pxzA	1	0.8852	3	0.935	Contact Map
4tq3A	1	0.9426	2.8	0.936	Contact Map
4ea3A	2	0.8607	2.5	0.938	Contact Map
1v96A	2	0.418	2.5	0.938	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.