Mucin_bdg - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Mucin_bdg - Putative mucin or carbohydrate-binding module

PFAM:	PF03272	Sequences: TFKGLGDREFATVTLDLETKKLTVTVTAGQPHSYFGNETYASITVYDANGKEVYNKEIIGNSKNFAENGVPFEYGDVIKVYHAEPDNRLITNNDNNKKLEKKGKTNTYKVTKNGL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	115 (114)
Sequences:	587 (414)
Seq/√Len:	38.7
META:	0.235

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
10_F	41_A	3.790	1.00
47_D	51_K	3.467	1.00
32_H	84_E	3.365	1.00
53_V	76_D	3.130	1.00
2_F	89_L	3.019	1.00
111_T	114_G	2.804	1.00
5_L	33_S	2.390	1.00
83_A	104_K	2.305	1.00
5_L	34_Y	2.174	0.99
16_D	19_T	2.110	0.99
39_T	57_E	2.106	0.99
22_L	45_V	1.982	0.99
35_F	84_E	1.956	0.99
40_Y	84_E	1.933	0.98
44_T	79_K	1.919	0.98
46_Y	79_K	1.844	0.98
8_R	29_G	1.813	0.98
93_N	97_K	1.722	0.97
35_F	83_A	1.708	0.97
20_K	73_E	1.698	0.96
48_A	73_E	1.664	0.96
47_D	76_D	1.644	0.96
5_L	8_R	1.602	0.95
6_G	34_Y	1.590	0.95
74_Y	112_K	1.545	0.94
35_F	60_G	1.534	0.94
6_G	32_H	1.429	0.91
79_K	105_T	1.370	0.89
84_E	88_R	1.348	0.88
95_N	98_K	1.341	0.88
73_E	76_D	1.339	0.88
21_K	71_P	1.339	0.88
91_T	97_K	1.307	0.87
34_Y	60_G	1.300	0.86
17_L	72_F	1.286	0.86
82_H	89_L	1.278	0.86
39_T	42_S	1.263	0.85
78_I	115_L	1.236	0.84
32_H	35_F	1.233	0.83
52_E	55_N	1.227	0.83
23_T	69_G	1.222	0.83
47_D	50_G	1.206	0.82
41_A	82_H	1.153	0.79
32_H	40_Y	1.128	0.77
72_F	110_V	1.124	0.77
11_A	24_V	1.097	0.75
31_P	58_I	1.096	0.75
9_E	12_T	1.065	0.73
38_E	83_A	1.061	0.73
21_K	69_G	1.025	0.70
10_F	82_H	1.017	0.70
40_Y	82_H	0.996	0.68
32_H	88_R	0.993	0.68
102_K	112_K	0.979	0.67
77_V	109_K	0.954	0.65
92_N	95_N	0.953	0.65
10_F	58_I	0.952	0.65
94_D	108_Y	0.943	0.64
24_V	115_L	0.935	0.63
61_N	80_V	0.929	0.63
53_V	73_E	0.928	0.63
13_V	24_V	0.925	0.62
46_Y	77_V	0.914	0.61
24_V	70_V	0.911	0.61
24_V	76_D	0.897	0.60
2_F	13_V	0.895	0.60
93_N	99_L	0.895	0.60
14_T	25_T	0.895	0.60
17_L	76_D	0.881	0.58
17_L	89_L	0.879	0.58
26_V	58_I	0.871	0.58
30_Q	33_S	0.869	0.57
48_A	76_D	0.868	0.57
41_A	58_I	0.865	0.57
26_V	54_Y	0.851	0.56
90_I	108_Y	0.842	0.55
54_Y	77_V	0.838	0.55
26_V	71_P	0.834	0.54
6_G	23_T	0.833	0.54
50_G	77_V	0.831	0.54
94_D	99_L	0.823	0.53
73_E	112_K	0.817	0.53
78_I	110_V	0.814	0.53
111_T	115_L	0.806	0.52
46_Y	52_E	0.806	0.52
72_F	108_Y	0.803	0.52
99_L	106_N	0.799	0.51
90_I	94_D	0.794	0.51
15_L	66_A	0.788	0.50
72_F	79_K	0.786	0.50
10_F	31_P	0.785	0.50
100_E	106_N	0.785	0.50
31_P	61_N	0.770	0.49
107_T	115_L	0.757	0.47
29_G	45_V	0.756	0.47
44_T	52_E	0.744	0.46
90_I	99_L	0.735	0.45
56_K	75_G	0.723	0.44
63_K	67_E	0.719	0.44
54_Y	60_G	0.719	0.44
3_K	9_E	0.705	0.43
107_T	110_V	0.696	0.42
32_H	36_G	0.694	0.42
24_V	31_P	0.694	0.42
94_D	98_K	0.690	0.41
57_E	67_E	0.690	0.41
8_R	27_T	0.689	0.41
103_G	106_N	0.685	0.41
3_K	90_I	0.678	0.40
6_G	33_S	0.675	0.40
20_K	47_D	0.674	0.40
44_T	76_D	0.672	0.40
18_E	21_K	0.670	0.40
93_N	98_K	0.664	0.39
56_K	80_V	0.662	0.39
4_G	7_D	0.657	0.39
43_I	93_N	0.653	0.38
63_K	71_P	0.649	0.38
5_L	9_E	0.639	0.37
3_K	30_Q	0.635	0.37
106_N	115_L	0.631	0.36
34_Y	84_E	0.629	0.36
62_S	70_V	0.625	0.36
15_L	80_V	0.623	0.36
73_E	95_N	0.623	0.36
106_N	114_G	0.622	0.36
74_Y	111_T	0.614	0.35
43_I	101_K	0.613	0.35
4_G	40_Y	0.604	0.34
20_K	54_Y	0.601	0.34
105_T	108_Y	0.596	0.33
31_P	41_A	0.591	0.33
4_G	32_H	0.591	0.33
12_T	21_K	0.585	0.33
60_G	83_A	0.584	0.33
16_D	46_Y	0.578	0.32
11_A	58_I	0.575	0.32
25_T	28_A	0.570	0.31
22_L	61_N	0.568	0.31
13_V	43_I	0.567	0.31
7_D	55_N	0.566	0.31
45_V	54_Y	0.565	0.31
4_G	35_F	0.564	0.31
6_G	28_A	0.563	0.31
102_K	107_T	0.562	0.31
37_N	63_K	0.562	0.31
12_T	115_L	0.559	0.31
86_D	113_N	0.559	0.31
96_N	99_L	0.553	0.30
53_V	81_Y	0.549	0.30
49_N	53_V	0.547	0.30
14_T	49_N	0.547	0.30
86_D	101_K	0.543	0.29
75_G	111_T	0.535	0.29
3_K	76_D	0.534	0.29
10_F	88_R	0.531	0.28
53_V	80_V	0.528	0.28
66_A	98_K	0.526	0.28
42_S	81_Y	0.526	0.28
34_Y	88_R	0.522	0.28
68_N	76_D	0.520	0.28
32_H	41_A	0.519	0.28
78_I	94_D	0.518	0.28
35_F	38_E	0.513	0.27
42_S	53_V	0.512	0.27
93_N	100_E	0.509	0.27
60_G	115_L	0.508	0.27
55_N	70_V	0.507	0.27
19_T	104_K	0.504	0.27
52_E	77_V	0.502	0.26
52_E	71_P	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1n4kA	1	0.313	39.7	0.882	Contact Map
3d33A	1	0.7217	24	0.894	Contact Map
3isyA	1	0.8783	20.2	0.898	Contact Map
3h63A	1	0.3565	13.2	0.906	Contact Map
4yx7A	1	0.4957	8.4	0.914	Contact Map
4exrA	2	0.7043	8.2	0.915	Contact Map
3sd2A	2	0.6957	7.4	0.916	Contact Map
1yfbA	2	0.4522	6.7	0.918	Contact Map
2l66A	2	0.4609	6.5	0.918	Contact Map
3malA	1	0.3913	6.3	0.919	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.