Rer1 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Rer1 - Rer1 family

PFAM:	PF03248	Sequences: QTSKLSRRYQYYLDKSTPHVLYRWIGTLVLLLLFFLRVYLLQGWYIVTYALGIYLLNLFIAFLSPKFDPELEDDLADEELEDGPSLPTKGDDEFRPFIRRLPEFKFWYSATKATLIAFVCTFFSVFDVPVFWPILLMYFIVLFVLTMKRQIQHMIKYKYVPFSFGKKRYK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	170 (164)
Sequences:	638 (377)
Seq/√Len:	29.4
META:	0.281

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
34_F	48_T	4.090	1.00
27_T	111_T	4.028	1.00
143_F	147_M	3.891	1.00
124_S	127_D	3.822	1.00
50_A	120_C	3.442	1.00
9_Y	108_Y	2.973	1.00
116_I	120_C	2.889	1.00
54_Y	58_L	2.751	1.00
4_K	8_R	2.715	1.00
140_I	144_V	2.691	1.00
11_Y	15_K	2.495	0.99
148_K	152_Q	2.479	0.99
25_I	29_V	2.322	0.99
8_R	12_Y	2.282	0.99
10_Q	14_D	2.176	0.98
52_G	136_L	2.059	0.97
123_F	131_F	2.030	0.97
36_L	40_L	1.985	0.97
13_L	17_T	1.892	0.96
38_V	41_L	1.891	0.96
34_F	38_V	1.777	0.94
72_E	163_S	1.734	0.93
21_L	25_I	1.605	0.90
108_Y	112_K	1.600	0.90
119_V	123_F	1.545	0.88
60_I	64_S	1.523	0.87
44_W	127_D	1.512	0.87
38_V	42_Q	1.463	0.85
109_S	112_K	1.456	0.85
62_F	106_F	1.456	0.85
27_T	110_A	1.445	0.84
92_D	158_K	1.427	0.84
27_T	114_T	1.409	0.83
147_M	150_Q	1.407	0.83
41_L	44_W	1.402	0.82
62_F	99_R	1.388	0.82
55_L	110_A	1.388	0.82
118_F	122_F	1.387	0.82
97_F	161_P	1.361	0.81
34_F	118_F	1.359	0.80
44_W	124_S	1.351	0.80
145_L	152_Q	1.338	0.79
34_F	114_T	1.335	0.79
15_K	137_M	1.334	0.79
123_F	126_F	1.328	0.79
59_F	106_F	1.311	0.78
120_C	126_F	1.281	0.76
41_L	122_F	1.276	0.76
146_T	150_Q	1.243	0.74
34_F	39_Y	1.228	0.73
118_F	139_F	1.204	0.72
157_Y	162_F	1.204	0.72
115_L	119_V	1.192	0.71
103_E	107_W	1.188	0.71
112_K	163_S	1.179	0.70
35_F	48_T	1.179	0.70
50_A	134_I	1.176	0.70
18_P	98_I	1.174	0.70
45_Y	98_I	1.145	0.68
129_P	132_W	1.138	0.67
34_F	121_T	1.137	0.67
18_P	101_L	1.128	0.67
89_K	139_F	1.118	0.66
33_L	115_L	1.116	0.66
56_L	93_E	1.111	0.65
155_I	162_F	1.108	0.65
54_Y	62_F	1.107	0.65
81_E	157_Y	1.083	0.63
55_L	113_A	1.082	0.63
99_R	102_P	1.063	0.62
58_L	110_A	1.055	0.61
81_E	162_F	1.052	0.61
57_N	143_F	1.051	0.61
148_K	165_G	1.044	0.60
30_L	119_V	1.000	0.57
26_G	29_V	0.993	0.57
129_P	133_P	0.992	0.56
10_Q	60_I	0.990	0.56
43_G	132_W	0.985	0.56
61_A	66_K	0.985	0.56
64_S	98_I	0.983	0.56
93_E	97_F	0.976	0.55
41_L	148_K	0.976	0.55
34_F	41_L	0.964	0.54
51_L	104_F	0.959	0.54
154_M	159_Y	0.956	0.54
12_Y	145_L	0.955	0.54
31_L	114_T	0.950	0.53
102_P	134_I	0.948	0.53
120_C	141_V	0.943	0.53
61_A	101_L	0.939	0.52
15_K	25_I	0.934	0.52
3_S	136_L	0.915	0.50
56_L	131_F	0.915	0.50
39_Y	60_I	0.910	0.50
26_G	83_G	0.908	0.50
160_V	164_F	0.906	0.50
144_V	167_K	0.903	0.50
127_D	136_L	0.896	0.49
60_I	67_F	0.895	0.49
143_F	150_Q	0.891	0.49
22_Y	26_G	0.884	0.48
70_E	157_Y	0.882	0.48
120_C	155_I	0.882	0.48
80_L	160_V	0.880	0.48
18_P	94_F	0.861	0.46
130_V	138_Y	0.860	0.46
64_S	67_F	0.860	0.46
39_Y	118_F	0.855	0.46
55_L	114_T	0.846	0.45
154_M	161_P	0.841	0.45
46_I	141_V	0.836	0.44
121_T	148_K	0.834	0.44
79_E	86_L	0.831	0.44
80_L	84_P	0.830	0.44
54_Y	110_A	0.829	0.44
55_L	144_V	0.819	0.43
99_R	146_T	0.818	0.43
66_K	101_L	0.815	0.43
28_L	32_L	0.815	0.43
19_H	162_F	0.814	0.43
25_I	157_Y	0.812	0.42
3_S	6_S	0.808	0.42
26_G	36_L	0.804	0.42
125_V	128_V	0.802	0.42
30_L	111_T	0.801	0.42
66_K	98_I	0.801	0.42
42_Q	59_F	0.797	0.41
21_L	47_V	0.797	0.41
6_S	52_G	0.795	0.41
60_I	163_S	0.792	0.41
14_D	128_V	0.789	0.41
40_L	95_R	0.788	0.41
72_E	80_L	0.784	0.40
18_P	113_A	0.777	0.40
25_I	28_L	0.764	0.39
105_K	131_F	0.750	0.38
147_M	151_I	0.750	0.38
158_K	162_F	0.743	0.37
128_V	149_R	0.738	0.37
13_L	104_F	0.736	0.37
27_T	131_F	0.734	0.37
5_L	115_L	0.730	0.36
115_L	124_S	0.725	0.36
34_F	61_A	0.725	0.36
45_Y	94_F	0.724	0.36
3_S	33_L	0.723	0.36
14_D	18_P	0.723	0.36
126_F	145_L	0.722	0.36
12_Y	16_S	0.717	0.35
35_F	52_G	0.710	0.35
116_I	125_V	0.707	0.35
73_D	152_Q	0.707	0.35
5_L	36_L	0.703	0.34
160_V	163_S	0.702	0.34
59_F	84_P	0.699	0.34
155_I	158_K	0.698	0.34
12_Y	15_K	0.693	0.34
104_F	131_F	0.680	0.33
84_P	152_Q	0.679	0.33
110_A	114_T	0.674	0.32
85_S	114_T	0.672	0.32
58_L	98_I	0.671	0.32
31_L	117_A	0.670	0.32
166_K	169_Y	0.669	0.32
156_K	159_Y	0.668	0.32
3_S	7_R	0.664	0.32
61_A	100_R	0.660	0.31
19_H	71_L	0.656	0.31
119_V	125_V	0.655	0.31
90_G	168_R	0.650	0.31
164_F	167_K	0.650	0.31
29_V	127_D	0.647	0.30
22_Y	168_R	0.646	0.30
52_G	60_I	0.642	0.30
51_L	113_A	0.640	0.30
30_L	114_T	0.637	0.30
55_L	91_D	0.634	0.30
41_L	121_T	0.632	0.29
31_L	52_G	0.632	0.29
48_T	134_I	0.631	0.29
16_S	64_S	0.627	0.29
135_L	139_F	0.617	0.28
63_L	143_F	0.611	0.28
151_I	155_I	0.610	0.28
63_L	99_R	0.609	0.28
102_P	146_T	0.606	0.28
57_N	62_F	0.606	0.28
27_T	45_Y	0.603	0.28
101_L	105_K	0.602	0.28
102_P	106_F	0.600	0.27
98_I	113_A	0.600	0.27
4_K	7_R	0.597	0.27
62_F	101_L	0.596	0.27
45_Y	58_L	0.594	0.27
128_V	141_V	0.594	0.27
134_I	142_L	0.592	0.27
130_V	133_P	0.589	0.27
93_E	96_P	0.589	0.27
30_L	36_L	0.586	0.27
39_Y	116_I	0.584	0.26
17_T	59_F	0.583	0.26
159_Y	166_K	0.581	0.26
66_K	137_M	0.578	0.26
2_T	32_L	0.577	0.26
85_S	98_I	0.576	0.26
7_R	55_L	0.571	0.26
20_V	64_S	0.569	0.26
135_L	138_Y	0.568	0.25
38_V	50_A	0.566	0.25
33_L	36_L	0.563	0.25
60_I	140_I	0.559	0.25
130_V	135_L	0.555	0.25
33_L	140_I	0.554	0.25
11_Y	168_R	0.552	0.25
36_L	39_Y	0.550	0.24
134_I	139_F	0.546	0.24
61_A	136_L	0.542	0.24
4_K	29_V	0.541	0.24
161_P	166_K	0.540	0.24
97_F	134_I	0.538	0.24
42_Q	45_Y	0.534	0.23
136_L	142_L	0.534	0.23
46_I	142_L	0.534	0.23
100_R	157_Y	0.533	0.23
16_S	145_L	0.533	0.23
54_Y	146_T	0.532	0.23
73_D	136_L	0.529	0.23
92_D	118_F	0.523	0.23
133_P	138_Y	0.520	0.23
149_R	153_H	0.516	0.22
19_H	22_Y	0.513	0.22
48_T	121_T	0.511	0.22
30_L	40_L	0.511	0.22
50_A	101_L	0.510	0.22
64_S	69_P	0.510	0.22
136_L	167_K	0.509	0.22
22_Y	124_S	0.509	0.22
141_V	144_V	0.506	0.22
34_F	42_Q	0.506	0.22
115_L	122_F	0.506	0.22
89_K	160_V	0.505	0.22
2_T	139_F	0.505	0.22
115_L	156_K	0.500	0.22
46_I	53_I	0.500	0.22
51_L	108_Y	0.500	0.22

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3owtC	1	0.0824	16.4	0.959	Contact Map
4bpmA	3	0.3882	5.3	0.967	Contact Map
1ji6A	1	0.3588	4.1	0.969	Contact Map
2zjsY	2	0.7765	2.7	0.972	Contact Map
3dl8G	1	0.8176	2.5	0.972	Contact Map
3j01A	1	0.8941	2.1	0.973	Contact Map
3dinC	1	0.8	1.8	0.974	Contact Map
4od4A	1	0.7353	1.6	0.975	Contact Map
3ibpA	2	0.2706	1.4	0.976	Contact Map
4ec6A	3	0.0706	1.4	0.976	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.