BURP - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

BURP - BURP domain

PFAM:	PF03181	Sequences: VFFLEKDLKPGKKMPLPFIKDDDKSPKASFLPREIADSIPFSSSKLPEILNRFSVPPGSPEAKAMKDTLRECERPPIKGETKYCATSLESMVDFATSVLGTRNVRALSTEVVKGSTPKQNYTIGGVKKIKGTKSVACHKMPYPYAVFYCHSVPKTRVYEVSLVGEDGTKVEAVAVCHLDTSAWNPKHVAFQVLGVKPGTVPVCHFLPEDDIVWVP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	215 (212)
Sequences:	575 (372)
Seq/√Len:	25.5
META:	0.052

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
207_P	210_D	4.848	1.00
119_Q	164_G	4.326	1.00
33_R	93_D	3.524	1.00
183_W	190_F	3.460	1.00
180_T	183_W	3.384	1.00
50_L	62_A	2.872	1.00
183_W	187_H	2.860	1.00
86_T	146_V	2.604	0.99
49_I	65_M	2.417	0.99
187_H	190_F	2.413	0.99
186_K	191_Q	2.377	0.98
42_S	73_E	2.322	0.98
161_S	171_E	2.316	0.98
195_V	200_V	2.270	0.98
58_G	63_K	2.223	0.97
106_A	211_I	2.176	0.97
94_F	135_V	2.170	0.97
99_L	135_V	2.135	0.97
45_K	93_D	2.097	0.96
180_T	190_F	2.088	0.96
108_S	147_F	2.055	0.96
68_T	146_V	2.052	0.96
33_R	37_D	1.998	0.95
78_K	182_A	1.972	0.95
10_P	85_A	1.894	0.94
81_T	98_V	1.837	0.92
110_E	171_E	1.820	0.92
123_I	127_K	1.809	0.92
36_A	86_T	1.779	0.91
94_F	211_I	1.742	0.90
179_D	183_W	1.716	0.90
42_S	144_Y	1.687	0.89
59_S	62_A	1.673	0.88
13_K	120_N	1.652	0.88
49_I	142_Y	1.647	0.88
44_S	78_K	1.629	0.87
45_K	142_Y	1.628	0.87
178_L	184_N	1.628	0.87
59_S	164_G	1.614	0.86
136_A	155_T	1.605	0.86
32_P	35_I	1.599	0.86
136_A	170_V	1.584	0.85
95_A	154_K	1.572	0.85
143_P	147_F	1.566	0.85
157_V	178_L	1.533	0.83
148_Y	175_V	1.504	0.82
180_T	185_P	1.466	0.81
5_E	156_R	1.454	0.80
162_L	181_S	1.451	0.80
71_E	82_K	1.447	0.80
13_K	17_P	1.442	0.79
8_L	14_M	1.401	0.77
41_F	144_Y	1.389	0.77
159_E	171_E	1.371	0.76
100_G	108_S	1.369	0.76
50_L	54_S	1.365	0.76
71_E	140_M	1.359	0.75
56_P	65_M	1.356	0.75
41_F	142_Y	1.356	0.75
147_F	174_A	1.337	0.74
3_F	8_L	1.337	0.74
50_L	59_S	1.314	0.73
102_R	158_Y	1.297	0.72
33_R	40_P	1.266	0.70
43_S	73_E	1.265	0.70
180_T	187_H	1.248	0.69
146_V	166_D	1.242	0.68
181_S	190_F	1.231	0.68
18_F	170_V	1.222	0.67
6_K	43_S	1.217	0.67
34_E	142_Y	1.217	0.67
118_K	121_Y	1.203	0.66
196_K	210_D	1.169	0.63
194_G	214_V	1.155	0.63
68_T	102_R	1.133	0.61
113_K	116_T	1.112	0.60
106_A	123_I	1.106	0.59
192_V	212_V	1.100	0.59
109_T	172_A	1.097	0.58
31_L	187_H	1.086	0.58
135_V	173_V	1.084	0.58
152_V	192_V	1.079	0.57
16_L	170_V	1.076	0.57
92_V	156_R	1.073	0.57
71_E	94_F	1.069	0.56
39_I	42_S	1.068	0.56
37_D	69_L	1.067	0.56
85_A	198_G	1.052	0.55
60_P	64_A	1.048	0.55
34_E	173_V	1.046	0.55
53_F	164_G	1.043	0.55
53_F	175_V	1.038	0.54
7_D	12_K	1.030	0.54
25_S	44_S	1.026	0.53
109_T	173_V	1.024	0.53
88_L	145_A	1.016	0.53
198_G	204_H	1.016	0.53
1_V	16_L	1.014	0.52
190_F	193_L	0.996	0.51
97_S	213_W	0.993	0.51
63_K	169_K	0.990	0.51
57_P	86_T	0.987	0.50
109_T	208_E	0.985	0.50
138_H	150_H	0.980	0.50
90_S	186_K	0.979	0.50
66_K	70_R	0.978	0.50
147_F	191_Q	0.977	0.50
95_A	126_V	0.971	0.49
50_L	55_V	0.969	0.49
134_S	152_V	0.968	0.49
56_P	64_A	0.966	0.49
195_V	199_T	0.964	0.49
77_I	157_V	0.958	0.48
18_F	32_P	0.956	0.48
180_T	193_L	0.955	0.48
67_D	135_V	0.954	0.48
188_V	202_V	0.953	0.48
49_I	73_E	0.948	0.48
64_A	70_R	0.937	0.47
13_K	36_A	0.936	0.47
91_M	94_F	0.935	0.47
162_L	214_V	0.934	0.47
97_S	156_R	0.931	0.46
73_E	209_D	0.930	0.46
122_T	167_G	0.925	0.46
55_V	159_E	0.919	0.46
56_P	67_D	0.915	0.45
181_S	187_H	0.914	0.45
91_M	109_T	0.914	0.45
2_F	104_V	0.913	0.45
63_K	106_A	0.911	0.45
30_F	33_R	0.911	0.45
7_D	164_G	0.907	0.45
85_A	164_G	0.906	0.45
55_V	213_W	0.903	0.44
200_V	206_L	0.898	0.44
38_S	47_P	0.892	0.44
206_L	214_V	0.891	0.43
45_K	48_E	0.889	0.43
10_P	83_Y	0.880	0.43
59_S	119_Q	0.879	0.43
98_V	157_V	0.872	0.42
46_L	70_R	0.866	0.42
121_Y	129_I	0.865	0.42
62_A	205_F	0.864	0.42
41_F	53_F	0.862	0.41
55_V	65_M	0.862	0.41
121_Y	205_F	0.853	0.41
100_G	180_T	0.853	0.41
116_T	174_A	0.848	0.40
18_F	121_Y	0.839	0.40
121_Y	171_E	0.833	0.39
54_S	142_Y	0.828	0.39
185_P	196_K	0.826	0.39
92_V	152_V	0.823	0.39
126_V	129_I	0.821	0.39
163_V	175_V	0.819	0.38
111_V	114_G	0.817	0.38
141_P	199_T	0.817	0.38
43_S	59_S	0.804	0.37
28_A	99_L	0.796	0.37
109_T	193_L	0.794	0.37
65_M	142_Y	0.792	0.37
1_V	151_S	0.790	0.36
177_H	204_H	0.789	0.36
104_V	158_Y	0.789	0.36
65_M	70_R	0.788	0.36
93_D	186_K	0.788	0.36
49_I	56_P	0.787	0.36
47_P	143_P	0.786	0.36
50_L	61_E	0.786	0.36
58_G	65_M	0.785	0.36
160_V	205_F	0.783	0.36
81_T	108_S	0.781	0.36
17_P	25_S	0.779	0.36
13_K	163_V	0.778	0.36
96_T	123_I	0.776	0.35
49_I	53_F	0.775	0.35
86_T	209_D	0.771	0.35
136_A	194_G	0.766	0.35
121_Y	127_K	0.762	0.35
70_R	78_K	0.751	0.34
9_K	157_V	0.745	0.33
80_E	187_H	0.740	0.33
132_T	153_P	0.737	0.33
65_M	143_P	0.736	0.33
159_E	168_T	0.733	0.33
93_D	172_A	0.732	0.33
81_T	170_V	0.708	0.31
201_P	207_P	0.706	0.31
29_S	32_P	0.706	0.31
65_M	184_N	0.706	0.31
125_G	186_K	0.704	0.31
59_S	142_Y	0.702	0.31
158_Y	197_P	0.700	0.31
29_S	135_V	0.700	0.31
39_I	46_L	0.700	0.31
39_I	73_E	0.699	0.30
1_V	192_V	0.696	0.30
41_F	86_T	0.695	0.30
20_K	23_D	0.695	0.30
85_A	195_V	0.694	0.30
69_L	98_V	0.693	0.30
55_V	120_N	0.687	0.30
126_V	131_G	0.682	0.29
102_R	214_V	0.681	0.29
4_L	19_I	0.680	0.29
46_L	65_M	0.678	0.29
42_S	142_Y	0.677	0.29
66_K	77_I	0.674	0.29
18_F	77_I	0.673	0.29
56_P	161_S	0.671	0.29
49_I	54_S	0.670	0.29
103_N	110_E	0.669	0.29
147_F	184_N	0.668	0.29
180_T	184_N	0.668	0.29
82_K	198_G	0.667	0.29
4_L	104_V	0.666	0.28
47_P	62_A	0.665	0.28
66_K	123_I	0.661	0.28
30_F	213_W	0.660	0.28
66_K	104_V	0.660	0.28
6_K	19_I	0.655	0.28
10_P	46_L	0.655	0.28
15_P	152_V	0.648	0.27
26_P	77_I	0.645	0.27
12_K	20_K	0.642	0.27
193_L	198_G	0.640	0.27
100_G	198_G	0.639	0.27
105_R	129_I	0.634	0.27
126_V	174_A	0.634	0.27
52_R	55_V	0.634	0.27
13_K	116_T	0.629	0.26
132_T	194_G	0.627	0.26
169_K	174_A	0.625	0.26
65_M	192_V	0.622	0.26
33_R	41_F	0.622	0.26
15_P	81_T	0.622	0.26
41_F	59_S	0.617	0.26
78_K	94_F	0.615	0.26
15_P	64_A	0.614	0.25
24_K	76_P	0.604	0.25
82_K	94_F	0.604	0.25
163_V	169_K	0.604	0.25
9_K	12_K	0.603	0.25
85_A	196_K	0.602	0.25
3_F	179_D	0.602	0.25
20_K	130_K	0.600	0.25
38_S	65_M	0.599	0.25
90_S	170_V	0.598	0.25
41_F	146_V	0.598	0.25
13_K	106_A	0.595	0.24
46_L	143_P	0.593	0.24
129_I	214_V	0.593	0.24
175_V	212_V	0.588	0.24
124_G	163_V	0.587	0.24
188_V	210_D	0.585	0.24
35_I	165_E	0.584	0.24
129_I	168_T	0.583	0.24
134_S	192_V	0.579	0.24
10_P	102_R	0.579	0.24
72_C	100_G	0.578	0.24
204_H	213_W	0.577	0.23
86_T	164_G	0.576	0.23
28_A	205_F	0.575	0.23
18_F	207_P	0.575	0.23
154_K	160_V	0.573	0.23
82_K	193_L	0.573	0.23
59_S	193_L	0.571	0.23
9_K	133_K	0.571	0.23
6_K	13_K	0.571	0.23
188_V	192_V	0.569	0.23
92_V	174_A	0.568	0.23
73_E	123_I	0.565	0.23
95_A	128_K	0.558	0.22
108_S	142_Y	0.557	0.22
76_P	139_K	0.551	0.22
121_Y	124_G	0.550	0.22
133_K	161_S	0.550	0.22
119_Q	142_Y	0.549	0.22
152_V	174_A	0.548	0.22
81_T	191_Q	0.546	0.22
147_F	158_Y	0.546	0.22
142_Y	167_G	0.545	0.22
27_K	120_N	0.545	0.22
99_L	197_P	0.544	0.22
48_E	166_D	0.543	0.22
83_Y	108_S	0.541	0.22
18_F	205_F	0.540	0.22
20_K	112_V	0.539	0.22
29_S	129_I	0.539	0.22
174_A	207_P	0.538	0.21
51_N	136_A	0.537	0.21
83_Y	95_A	0.535	0.21
63_K	67_D	0.532	0.21
181_S	185_P	0.531	0.21
8_L	190_F	0.529	0.21
170_V	210_D	0.527	0.21
18_F	206_L	0.527	0.21
46_L	69_L	0.526	0.21
48_E	118_K	0.525	0.21
184_N	212_V	0.524	0.21
55_V	64_A	0.521	0.21
36_A	42_S	0.518	0.21
114_G	162_L	0.516	0.20
125_G	129_I	0.515	0.20
53_F	141_P	0.515	0.20
50_L	68_T	0.512	0.20
94_F	173_V	0.511	0.20
2_F	175_V	0.511	0.20
82_K	170_V	0.508	0.20
69_L	111_V	0.508	0.20
10_P	34_E	0.507	0.20
12_K	161_S	0.507	0.20
6_K	173_V	0.505	0.20
15_P	120_N	0.505	0.20
83_Y	188_V	0.502	0.20
131_G	208_E	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3n08A	2	0.3535	14.6	0.967	Contact Map
2afdA	1	0.4093	7.1	0.972	Contact Map
3pqhA	4	0.1581	6.3	0.972	Contact Map
1g0dA	1	0.2465	6.2	0.972	Contact Map
1hjrA	2	0.6279	5.1	0.973	Contact Map
4ep4A	2	0.6419	5	0.974	Contact Map
2m5rA	1	0.3674	3.9	0.975	Contact Map
3nbiA	1	0.2372	3.7	0.975	Contact Map
2xzzA	9	0.2372	3.5	0.976	Contact Map
1l0iA	1	0.3535	3.4	0.976	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0082 seconds.