TB2_DP1_HVA22 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TB2_DP1_HVA22 - TB2/DP1, HVA22 family

PFAM:	PF03134	Sequences: RLLCNLVGFLYPAYASFKALESKSKDKDDDTQWLTYWVVFGLFTLVESFLDFLLSWIPFYYELKLAFLLWLVLPQTRGATYIYEKFLRPF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	90 (86)
Sequences:	3107 (2218)
Seq/√Len:	239.2
META:	0.519

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
70_W	78_G	4.819	1.00
16_S	37_W	2.653	1.00
11_Y	15_A	2.528	1.00
12_P	36_Y	2.373	1.00
81_Y	85_K	2.356	1.00
24_S	30_D	2.337	1.00
47_E	64_K	2.200	1.00
32_Q	77_R	2.097	1.00
21_E	88_R	2.012	1.00
24_S	29_D	1.960	1.00
60_Y	64_K	1.938	1.00
80_T	84_E	1.833	1.00
77_R	80_T	1.715	1.00
33_W	36_Y	1.662	1.00
73_L	76_T	1.596	1.00
70_W	81_Y	1.563	1.00
14_Y	18_K	1.546	1.00
25_K	30_D	1.520	1.00
47_E	60_Y	1.500	1.00
5_N	9_F	1.490	1.00
16_S	34_L	1.431	1.00
8_G	68_L	1.413	1.00
15_A	18_K	1.328	1.00
43_F	68_L	1.321	1.00
9_F	40_F	1.316	1.00
4_C	65_L	1.307	1.00
17_F	21_E	1.307	1.00
69_L	73_L	1.244	1.00
51_D	56_W	1.234	1.00
27_K	31_T	1.229	1.00
21_E	83_Y	1.184	1.00
64_K	68_L	1.176	1.00
36_Y	40_F	1.155	1.00
32_Q	79_A	1.146	1.00
51_D	55_S	1.142	1.00
51_D	54_L	1.128	1.00
26_D	31_T	1.124	1.00
68_L	71_L	1.119	1.00
32_Q	80_T	1.089	1.00
30_D	34_L	1.084	1.00
37_W	40_F	1.078	1.00
52_F	55_S	1.071	1.00
25_K	28_D	1.048	1.00
26_D	29_D	1.044	1.00
68_L	72_V	1.002	1.00
35_T	79_A	0.997	1.00
38_V	41_G	0.989	1.00
32_Q	35_T	0.988	1.00
67_F	71_L	0.988	1.00
49_F	52_F	0.965	1.00
24_S	27_K	0.938	1.00
25_K	29_D	0.931	1.00
48_S	51_D	0.927	1.00
19_A	33_W	0.906	1.00
70_W	76_T	0.904	1.00
81_Y	86_F	0.891	1.00
25_K	31_T	0.887	0.99
46_V	50_L	0.884	0.99
8_G	12_P	0.884	0.99
11_Y	33_W	0.873	0.99
28_D	31_T	0.869	0.99
9_F	13_A	0.869	0.99
2_L	5_N	0.862	0.99
69_L	72_V	0.853	0.99
47_E	56_W	0.840	0.99
84_E	88_R	0.830	0.99
50_L	53_L	0.809	0.99
76_T	79_A	0.784	0.99
31_T	84_E	0.769	0.99
7_V	65_L	0.761	0.98
73_L	77_R	0.754	0.98
8_G	40_F	0.746	0.98
62_E	66_A	0.722	0.98
35_T	84_E	0.720	0.98
35_T	38_V	0.715	0.98
15_A	75_Q	0.706	0.97
16_S	74_P	0.700	0.97
39_V	42_L	0.696	0.97
13_A	21_E	0.690	0.97
61_Y	64_K	0.685	0.97
86_F	89_P	0.678	0.97
27_K	30_D	0.671	0.97
13_A	71_L	0.659	0.96
42_L	46_V	0.655	0.96
51_D	59_F	0.651	0.96
6_L	10_L	0.642	0.96
5_N	48_S	0.641	0.96
51_D	63_L	0.639	0.95
20_L	40_F	0.638	0.95
39_V	64_K	0.631	0.95
41_G	44_T	0.630	0.95
26_D	77_R	0.630	0.95
83_Y	88_R	0.621	0.95
9_F	44_T	0.617	0.95
47_E	51_D	0.616	0.94
28_D	80_T	0.613	0.94
43_F	47_E	0.613	0.94
33_W	37_W	0.607	0.94
19_A	30_D	0.607	0.94
5_N	8_G	0.594	0.93
3_L	15_A	0.593	0.93
46_V	84_E	0.589	0.93
56_W	59_F	0.564	0.91
40_F	68_L	0.556	0.91
63_L	67_F	0.553	0.91
85_K	89_P	0.548	0.90
80_T	86_F	0.548	0.90
43_F	51_D	0.547	0.90
56_W	62_E	0.545	0.90
2_L	51_D	0.543	0.90
2_L	48_S	0.542	0.90
45_L	50_L	0.542	0.90
9_F	41_G	0.542	0.90
46_V	52_F	0.538	0.89
39_V	87_L	0.538	0.89
74_P	78_G	0.538	0.89
42_L	55_S	0.535	0.89
17_F	74_P	0.533	0.89
30_D	40_F	0.530	0.89
43_F	55_S	0.526	0.88
32_Q	41_G	0.525	0.88
46_V	55_S	0.525	0.88
69_L	74_P	0.523	0.88
26_D	30_D	0.521	0.88
76_T	80_T	0.518	0.88
42_L	80_T	0.517	0.88
36_Y	74_P	0.512	0.87
72_V	76_T	0.506	0.86
65_L	72_V	0.500	0.86

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2b1eA	1	0.5333	1.5	0.913	Contact Map
1z96A	1	0.3889	1.3	0.917	Contact Map
2micA	2	0.2778	1.1	0.919	Contact Map
4i5sA	2	0.1556	1	0.921	Contact Map
2vdwB	1	0.3889	1	0.922	Contact Map
2a8eA	1	0.2333	1	0.923	Contact Map
3qnqA	2	0.3667	0.8	0.926	Contact Map
2oniA	4	0.3222	0.7	0.929	Contact Map
3froA	3	0.3333	0.7	0.931	Contact Map
4l6vi	1	0.3	0.6	0.932	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.