Sterile - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Sterile - Male sterility protein

PFAM:	PF03015	Sequences: LHLLPAYLLDLLLRLTGKKPRLVKLYRKIHKALELFEPFTTNEWVFDNDNTRALRARLSPEDRKLFNFDPESIDWEDYFLNYIPGLRKYVLKE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	93 (90)
Sequences:	2673 (1870)
Seq/√Len:	197.2
META:	0.451

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
67_N	72_S	2.713	1.00
39_F	42_N	2.701	1.00
60_P	63_R	2.637	1.00
70_P	73_I	2.629	1.00
38_P	42_N	2.188	1.00
77_D	81_N	2.145	1.00
69_D	72_S	2.095	1.00
48_N	52_R	2.029	1.00
7_Y	23_V	1.946	1.00
84_P	88_K	1.932	1.00
55_R	68_F	1.928	1.00
50_N	53_A	1.921	1.00
26_Y	29_I	1.873	1.00
55_R	63_R	1.840	1.00
6_A	10_D	1.764	1.00
28_K	32_A	1.722	1.00
26_Y	30_H	1.702	1.00
11_L	14_R	1.644	1.00
59_S	62_D	1.540	1.00
39_F	44_W	1.465	1.00
37_E	40_T	1.422	1.00
61_E	64_K	1.415	1.00
36_F	40_T	1.394	1.00
77_D	80_L	1.333	1.00
30_H	33_L	1.332	1.00
23_V	27_R	1.319	1.00
14_R	20_P	1.314	1.00
3_L	7_Y	1.304	1.00
10_D	13_L	1.297	1.00
75_W	82_Y	1.275	1.00
32_A	35_L	1.253	1.00
52_R	71_E	1.248	1.00
8_L	14_R	1.212	1.00
10_D	20_P	1.206	1.00
10_D	18_K	1.201	1.00
16_T	19_K	1.172	1.00
25_L	32_A	1.152	1.00
80_L	84_P	1.131	1.00
86_L	90_V	1.128	1.00
28_K	33_L	1.115	1.00
60_P	64_K	1.109	1.00
36_F	39_F	1.104	1.00
25_L	28_K	1.097	1.00
58_L	63_R	1.084	1.00
52_R	56_A	1.068	1.00
74_D	77_D	1.067	1.00
69_D	73_I	1.052	1.00
8_L	11_L	1.051	1.00
7_Y	10_D	1.045	1.00
34_E	37_E	1.023	1.00
66_F	79_F	1.003	1.00
3_L	30_H	1.002	1.00
69_D	75_W	1.002	1.00
35_L	38_P	0.981	0.99
36_F	84_P	0.955	0.99
70_P	75_W	0.955	0.99
44_W	82_Y	0.926	0.99
48_N	68_F	0.922	0.99
49_D	56_A	0.914	0.99
24_K	31_K	0.912	0.99
27_R	31_K	0.911	0.99
12_L	15_L	0.906	0.99
12_L	16_T	0.891	0.99
37_E	41_T	0.890	0.99
89_Y	92_K	0.878	0.99
76_E	81_N	0.875	0.99
4_L	7_Y	0.859	0.99
87_R	90_V	0.857	0.99
38_P	44_W	0.792	0.98
24_K	29_I	0.792	0.98
39_F	89_Y	0.788	0.98
35_L	39_F	0.787	0.98
29_I	32_A	0.778	0.97
32_A	36_F	0.769	0.97
56_A	63_R	0.767	0.97
81_N	84_P	0.765	0.97
10_D	17_G	0.763	0.97
76_E	80_L	0.741	0.97
75_W	78_Y	0.739	0.96
38_P	82_Y	0.735	0.96
59_S	63_R	0.721	0.96
87_R	91_L	0.719	0.96
53_A	56_A	0.704	0.95
28_K	31_K	0.695	0.95
11_L	16_T	0.695	0.95
53_A	64_K	0.694	0.95
21_R	33_L	0.686	0.95
24_K	28_K	0.685	0.95
55_R	67_N	0.681	0.94
75_W	86_L	0.677	0.94
7_Y	14_R	0.677	0.94
43_E	46_F	0.665	0.94
66_F	69_D	0.663	0.94
44_W	85_G	0.660	0.94
13_L	16_T	0.651	0.93
48_N	51_T	0.649	0.93
62_D	65_L	0.637	0.92
49_D	57_R	0.624	0.92
26_Y	32_A	0.622	0.91
8_L	15_L	0.621	0.91
18_K	62_D	0.617	0.91
51_T	75_W	0.607	0.90
29_I	33_L	0.606	0.90
55_R	69_D	0.605	0.90
50_N	68_F	0.603	0.90
15_L	19_K	0.600	0.90
7_Y	11_L	0.597	0.90
8_L	12_L	0.596	0.90
11_L	18_K	0.586	0.89
59_S	64_K	0.580	0.88
39_F	85_G	0.580	0.88
23_V	36_F	0.579	0.88
6_A	9_L	0.560	0.87
12_L	18_K	0.559	0.86
4_L	45_V	0.558	0.86
9_L	22_L	0.557	0.86
51_T	68_F	0.554	0.86
9_L	13_L	0.547	0.85
13_L	18_K	0.545	0.85
32_A	86_L	0.539	0.84
53_A	57_R	0.539	0.84
57_R	62_D	0.538	0.84
8_L	13_L	0.535	0.84
48_N	87_R	0.528	0.83
10_D	15_L	0.526	0.83
15_L	20_P	0.523	0.83
39_F	46_F	0.522	0.82
48_N	71_E	0.521	0.82
22_L	32_A	0.521	0.82
80_L	83_I	0.516	0.82
3_L	12_L	0.515	0.82
41_T	87_R	0.515	0.82
58_L	64_K	0.502	0.80
12_L	21_R	0.502	0.80
11_L	15_L	0.500	0.80

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3st7A	2	0.9785	72.3	0.84	Contact Map
2gn4A	5	0.5914	60.1	0.852	Contact Map
2cm2A	1	0.4731	8.7	0.904	Contact Map
4adnA	2	0.9462	7.8	0.906	Contact Map
2eo2A	1	0.6344	7.2	0.907	Contact Map
1jv1A	2	0.6022	5	0.914	Contact Map
1ni3A	1	0.9892	4.1	0.918	Contact Map
3zxuA	1	0.8495	3.8	0.919	Contact Map
4a4aA	1	0.9677	3.5	0.921	Contact Map
3balA	4	0.4194	3.4	0.921	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.