DDT - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DDT - DDT domain

PFAM:	PF02791	Sequences: ESVGDLLMVWEFLNVFGEVLGLSPFTLDDFVAALLHSDPDGPSELLDEIHVALLKALLRD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	60 (58)
Sequences:	1139 (715)
Seq/√Len:	93.8
META:	0.395

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
9_V	30_F	3.300	1.00
13_L	22_L	2.795	1.00
13_L	49_I	2.314	1.00
6_L	31_V	2.291	1.00
25_F	45_L	2.245	1.00
39_P	42_P	1.912	1.00
9_V	16_F	1.828	1.00
5_D	8_M	1.729	1.00
30_F	34_L	1.656	1.00
11_E	27_L	1.615	1.00
16_F	20_L	1.614	1.00
11_E	48_E	1.599	1.00
10_W	14_N	1.590	1.00
33_A	46_L	1.571	1.00
50_H	57_L	1.492	1.00
21_G	35_L	1.462	1.00
38_D	41_G	1.367	0.99
25_F	43_S	1.327	0.99
12_F	20_L	1.299	0.99
8_M	27_L	1.297	0.99
52_A	55_K	1.250	0.99
39_P	47_D	1.230	0.98
4_G	12_F	1.196	0.98
20_L	52_A	1.153	0.98
13_L	53_L	1.132	0.97
14_N	23_S	1.120	0.97
30_F	46_L	1.089	0.97
50_H	53_L	1.087	0.97
12_F	53_L	1.055	0.96
11_E	58_L	1.046	0.96
13_L	31_V	0.973	0.94
28_D	36_H	0.971	0.94
4_G	54_L	0.969	0.94
34_L	54_L	0.968	0.94
13_L	25_F	0.953	0.93
48_E	51_V	0.908	0.91
29_D	51_V	0.906	0.91
25_F	52_A	0.888	0.90
10_W	23_S	0.886	0.90
11_E	31_V	0.875	0.90
18_E	21_G	0.865	0.89
44_E	48_E	0.845	0.88
9_V	19_V	0.843	0.88
12_F	31_V	0.798	0.85
31_V	35_L	0.796	0.85
3_V	55_K	0.795	0.85
5_D	47_D	0.782	0.84
32_A	37_S	0.764	0.82
6_L	27_L	0.743	0.80
22_L	52_A	0.742	0.80
29_D	48_E	0.739	0.80
23_S	45_L	0.731	0.79
51_V	58_L	0.720	0.78
28_D	48_E	0.707	0.77
30_F	45_L	0.705	0.77
18_E	29_D	0.702	0.77
4_G	15_V	0.687	0.75
4_G	32_A	0.674	0.74
8_M	12_F	0.634	0.69
36_H	42_P	0.624	0.68
3_V	36_H	0.623	0.68
32_A	38_D	0.614	0.67
8_M	37_S	0.614	0.67
11_E	56_A	0.601	0.65
24_P	57_L	0.594	0.64
55_K	58_L	0.593	0.64
27_L	42_P	0.592	0.64
9_V	39_P	0.592	0.64
5_D	39_P	0.584	0.63
11_E	16_F	0.584	0.63
6_L	11_E	0.579	0.62
7_L	57_L	0.577	0.62
12_F	16_F	0.567	0.60
12_F	17_G	0.562	0.60
29_D	50_H	0.554	0.59
26_T	59_R	0.544	0.57
9_V	41_G	0.543	0.57
30_F	49_I	0.541	0.57
16_F	57_L	0.535	0.56
31_V	58_L	0.535	0.56
3_V	7_L	0.532	0.56
8_M	18_E	0.531	0.55
43_S	54_L	0.520	0.54
47_D	50_H	0.518	0.54
5_D	15_V	0.513	0.53
26_T	35_L	0.502	0.51
17_G	56_A	0.500	0.51

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2y9yB	1	1	80	0.723	Contact Map
4cemA	1	0.9667	7.2	0.85	Contact Map
2wx4A	3	0.7167	4.6	0.863	Contact Map
2ahmA	2	0.45	3.6	0.871	Contact Map
4jpzB	1	0.9833	3.2	0.873	Contact Map
3ub0B	2	0.6167	3	0.875	Contact Map
3q3eA	1	0.65	2.7	0.879	Contact Map
4wbdA	2	0.9	2.7	0.879	Contact Map
4ycuA	3	0.9	2.6	0.879	Contact Map
4dckA	3	0.9833	2.5	0.881	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.