Na_Pi_cotrans - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Na_Pi_cotrans - Na+/Pi-cotransporter

PFAM:	PF02690	Sequences: LFLFGMKLMSDGLKKLAGDRLRRILAKLTSNPLLGVLVGALVTALIQSSSATTVMVVGFVNAGLLTLAQAIGVILGANIGTTITAQLVSLGAFKIAALALPLIGIGVLLFLFSKKKRLKNIGRILLGFGLLFLGLDLMS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	139 (138)
Sequences:	26292 (15686)
Seq/√Len:	1335.3
META:	0.874

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
56_V	73_V	3.132	1.00
31_N	34_L	3.003	1.00
30_S	34_L	2.989	1.00
94_K	97_A	2.780	1.00
66_T	69_Q	2.723	1.00
99_A	103_I	2.541	1.00
44_A	83_I	2.419	1.00
4_F	8_L	2.357	1.00
115_K	118_L	2.303	1.00
52_T	77_A	2.266	1.00
36_V	79_I	2.149	1.00
133_L	137_L	2.136	1.00
7_K	11_D	2.130	1.00
23_R	27_K	2.102	1.00
20_R	23_R	2.089	1.00
110_F	123_R	1.960	1.00
53_T	57_V	1.827	1.00
19_D	23_R	1.707	1.00
97_A	101_P	1.653	1.00
53_T	74_I	1.630	1.00
97_A	100_L	1.628	1.00
120_N	123_R	1.602	1.00
113_S	118_L	1.549	1.00
22_R	26_A	1.508	1.00
129_G	132_F	1.496	1.00
109_L	122_G	1.483	1.00
14_K	17_A	1.436	1.00
125_L	129_G	1.417	1.00
32_P	72_G	1.399	1.00
96_A	99_A	1.394	1.00
86_Q	89_S	1.381	1.00
104_G	108_L	1.369	1.00
19_D	22_R	1.357	1.00
95_I	98_L	1.308	1.00
119_K	123_R	1.304	1.00
92_A	97_A	1.284	1.00
1_L	130_L	1.278	1.00
10_S	14_K	1.259	1.00
118_L	121_I	1.253	1.00
81_T	84_T	1.252	1.00
101_P	104_G	1.238	1.00
53_T	77_A	1.227	1.00
56_V	70_A	1.217	1.00
107_V	111_L	1.207	1.00
99_A	102_L	1.196	1.00
23_R	26_A	1.176	1.00
18_G	22_R	1.163	1.00
52_T	73_V	1.157	1.00
46_I	52_T	1.151	1.00
35_G	72_G	1.150	1.00
121_I	125_L	1.148	1.00
98_L	101_P	1.147	1.00
103_I	106_G	1.143	1.00
109_L	113_S	1.137	1.00
102_L	106_G	1.130	1.00
126_L	129_G	1.125	1.00
42_V	52_T	1.102	1.00
93_F	97_A	1.088	1.00
129_G	133_L	1.078	1.00
11_D	14_K	1.076	1.00
5_G	134_G	1.069	1.00
95_I	102_L	1.063	1.00
93_F	100_L	1.059	1.00
68_A	72_G	1.050	1.00
117_R	120_N	1.040	1.00
58_G	62_A	1.038	1.00
16_L	121_I	1.037	1.00
46_I	51_A	1.028	1.00
100_L	103_I	1.024	1.00
107_V	110_F	1.011	1.00
108_L	112_F	1.009	1.00
96_A	136_D	1.004	1.00
95_I	99_A	0.997	1.00
11_D	15_K	0.995	1.00
40_A	83_I	0.988	1.00
74_I	78_N	0.986	1.00
92_A	96_A	0.981	1.00
110_F	113_S	0.974	1.00
94_K	99_A	0.974	1.00
116_K	119_K	0.974	1.00
104_G	107_V	0.973	1.00
100_L	104_G	0.969	1.00
83_I	86_Q	0.963	1.00
112_F	118_L	0.960	1.00
27_K	30_S	0.956	1.00
32_P	68_A	0.945	1.00
113_S	119_K	0.944	1.00
103_I	129_G	0.940	1.00
92_A	95_I	0.939	1.00
29_T	69_Q	0.918	1.00
97_A	103_I	0.918	1.00
110_F	119_K	0.917	1.00
60_V	70_A	0.889	1.00
121_I	124_I	0.887	1.00
58_G	61_N	0.886	1.00
15_K	123_R	0.883	1.00
7_K	10_S	0.881	1.00
33_L	37_L	0.880	1.00
84_T	88_V	0.868	1.00
101_P	105_I	0.859	1.00
102_L	105_I	0.856	1.00
75_L	78_N	0.848	1.00
27_K	34_L	0.844	1.00
47_Q	50_S	0.842	1.00
66_T	70_A	0.838	1.00
35_G	73_V	0.834	1.00
20_R	24_I	0.831	1.00
12_G	15_K	0.830	1.00
100_L	133_L	0.828	1.00
93_F	96_A	0.826	1.00
82_T	86_Q	0.824	1.00
92_A	103_I	0.821	1.00
122_G	125_L	0.819	1.00
117_R	121_I	0.819	1.00
96_A	103_I	0.817	1.00
37_L	41_L	0.816	1.00
48_S	51_A	0.810	1.00
97_A	102_L	0.810	1.00
93_F	99_A	0.802	1.00
95_I	100_L	0.798	1.00
94_K	101_P	0.796	1.00
113_S	116_K	0.787	1.00
37_L	40_A	0.782	1.00
71_I	75_L	0.782	1.00
56_V	77_A	0.782	1.00
92_A	99_A	0.776	1.00
8_L	11_D	0.775	1.00
36_V	76_G	0.772	1.00
44_A	47_Q	0.764	1.00
109_L	112_F	0.762	1.00
103_I	107_V	0.756	1.00
123_R	127_G	0.753	1.00
10_S	13_L	0.735	1.00
94_K	103_I	0.731	1.00
12_G	123_R	0.731	1.00
107_V	126_L	0.731	1.00
57_V	61_N	0.730	1.00
67_L	70_A	0.726	1.00
126_L	130_L	0.723	1.00
92_A	101_P	0.722	1.00
93_F	106_G	0.704	1.00
41_L	45_L	0.703	1.00
116_K	120_N	0.698	1.00
43_T	52_T	0.698	1.00
7_K	14_K	0.697	1.00
47_Q	84_T	0.692	1.00
34_L	38_V	0.676	1.00
54_V	58_G	0.674	1.00
119_K	125_L	0.669	1.00
97_A	104_G	0.667	1.00
42_V	46_I	0.667	1.00
96_A	102_L	0.661	1.00
95_I	103_I	0.655	1.00
39_G	73_V	0.651	1.00
49_S	81_T	0.650	1.00
18_G	21_L	0.647	1.00
96_A	100_L	0.636	1.00
133_L	136_D	0.634	1.00
46_I	55_M	0.630	1.00
59_F	64_L	0.626	1.00
109_L	118_L	0.625	1.00
42_V	55_M	0.620	1.00
103_I	133_L	0.617	1.00
88_V	91_G	0.614	1.00
36_V	75_L	0.608	1.00
36_V	72_G	0.608	1.00
36_V	40_A	0.604	1.00
40_A	79_I	0.599	1.00
56_V	65_L	0.598	1.00
101_P	106_G	0.597	1.00
12_G	16_L	0.597	1.00
47_Q	87_L	0.596	1.00
78_N	85_A	0.592	1.00
40_A	44_A	0.587	1.00
106_G	122_G	0.583	1.00
125_L	128_F	0.580	1.00
98_L	103_I	0.573	1.00
17_A	20_R	0.572	1.00
9_M	12_G	0.571	1.00
126_L	133_L	0.570	1.00
68_A	71_I	0.570	1.00
94_K	100_L	0.567	1.00
124_I	127_G	0.565	1.00
130_L	133_L	0.563	1.00
96_A	106_G	0.561	1.00
57_V	60_V	0.557	1.00
99_A	129_G	0.557	1.00
35_G	69_Q	0.556	1.00
122_G	129_G	0.552	1.00
93_F	98_L	0.551	1.00
120_N	124_I	0.551	1.00
97_A	106_G	0.548	1.00
15_K	120_N	0.546	1.00
107_V	112_F	0.542	1.00
32_P	35_G	0.537	1.00
94_K	98_L	0.537	1.00
39_G	56_V	0.536	1.00
12_G	127_G	0.534	1.00
34_L	37_L	0.531	1.00
6_M	10_S	0.521	1.00
72_G	75_L	0.520	1.00
29_T	73_V	0.516	1.00
74_I	77_A	0.509	1.00
100_L	106_G	0.509	1.00
99_A	106_G	0.508	1.00
69_Q	72_G	0.506	1.00
9_M	13_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4f35D	2	0.9281	2.1	0.926	Contact Map
1pw4A	1	0.9353	1.7	0.93	Contact Map
3wu2I	1	0.2734	1.4	0.933	Contact Map
2wscK	1	0.4676	1.1	0.936	Contact Map
1fdmA	1	0.1223	1.1	0.938	Contact Map
3i33A	1	0.3453	1	0.938	Contact Map
4xk8K	1	0.223	1	0.94	Contact Map
3o7qA	1	0.7914	0.9	0.941	Contact Map
3ip0A	2	0.4748	0.9	0.941	Contact Map
3wu2J	1	0.1007	0.8	0.942	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.