KdpC - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

KdpC - K+-transporting ATPase, c chain

PFAM:	PF02669	Sequences: IRPALRLTLVLTVLTGLAYPLAVTGIAQVLFPDQANGSLIERDGKVVGSELIGQPFTDPKYFHGRPSAAGYDAAASGGSNLGPTNPALIDRVKARVAALRAENPGAPTAPVPVDLVTASGSGLDPHISPAAALYQVPRVAKARGLSEAQVRALVAAHTEGRQLGFLGEPRVNVLELNLALDR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	182 (179)
Sequences:	18565 (11426)
Seq/√Len:	854.0
META:	0.873

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
91_R	95_R	3.086	1.00
115_L	131_A	2.963	1.00
133_L	151_R	2.829	1.00
2_R	6_R	2.725	1.00
28_Q	36_N	2.519	1.00
137_P	147_E	2.476	1.00
149_Q	152_A	2.314	1.00
39_L	46_V	2.303	1.00
61_Y	181_D	2.292	1.00
133_L	155_A	2.233	1.00
41_E	46_V	2.193	1.00
33_D	50_E	2.183	1.00
97_A	101_A	2.124	1.00
152_A	156_A	2.041	1.00
50_E	175_E	1.992	1.00
157_H	179_A	1.974	1.00
62_F	176_L	1.971	1.00
126_H	159_E	1.964	1.00
63_H	102_E	1.950	1.00
133_L	158_T	1.924	1.00
86_P	90_D	1.916	1.00
136_V	147_E	1.870	1.00
136_V	154_V	1.867	1.00
146_S	149_Q	1.854	1.00
126_H	170_R	1.775	1.00
26_I	30_L	1.744	1.00
8_T	12_T	1.729	1.00
53_G	64_G	1.724	1.00
96_V	116_V	1.720	1.00
147_E	151_R	1.699	1.00
93_K	97_A	1.697	1.00
162_Q	166_L	1.693	1.00
90_D	94_A	1.655	1.00
159_E	170_R	1.641	1.00
151_R	155_A	1.631	1.00
129_P	158_T	1.627	1.00
89_I	93_K	1.617	1.00
87_A	90_D	1.616	1.00
48_G	174_L	1.563	1.00
90_D	93_K	1.515	1.00
91_R	118_A	1.475	1.00
106_A	109_A	1.458	1.00
127_I	132_A	1.444	1.00
145_L	150_V	1.438	1.00
136_V	151_R	1.431	1.00
145_L	149_Q	1.414	1.00
76_S	123_L	1.412	1.00
159_E	175_E	1.392	1.00
103_N	106_A	1.356	1.00
42_R	45_K	1.346	1.00
162_Q	170_R	1.319	1.00
115_L	134_Y	1.315	1.00
94_A	98_A	1.305	1.00
95_R	98_A	1.302	1.00
157_H	175_E	1.296	1.00
137_P	141_K	1.293	1.00
55_P	70_G	1.264	1.00
98_A	102_E	1.259	1.00
156_A	179_A	1.244	1.00
62_F	139_V	1.239	1.00
7_L	11_L	1.237	1.00
58_D	61_Y	1.231	1.00
160_G	169_P	1.230	1.00
129_P	133_L	1.225	1.00
133_L	136_V	1.222	1.00
18_A	22_A	1.213	1.00
96_V	100_R	1.190	1.00
38_S	51_L	1.184	1.00
96_V	111_V	1.174	1.00
99_L	131_A	1.164	1.00
11_L	15_T	1.162	1.00
41_E	44_G	1.153	1.00
87_A	91_R	1.143	1.00
32_P	36_N	1.138	1.00
148_A	152_A	1.136	1.00
81_L	85_N	1.134	1.00
42_R	178_L	1.127	1.00
136_V	150_V	1.126	1.00
161_R	169_P	1.125	1.00
69_A	72_D	1.124	1.00
113_V	117_T	1.093	1.00
55_P	64_G	1.089	1.00
61_Y	143_R	1.086	1.00
99_L	134_Y	1.085	1.00
141_K	144_G	1.085	1.00
143_R	181_D	1.072	1.00
59_P	102_E	1.059	1.00
153_L	176_L	1.052	1.00
100_R	105_G	1.044	1.00
25_G	29_V	1.040	1.00
161_R	168_E	1.035	1.00
42_R	47_V	1.031	1.00
105_G	108_T	1.029	1.00
3_P	6_R	1.017	1.00
131_A	134_Y	1.017	1.00
152_A	155_A	1.017	1.00
95_R	118_A	1.012	1.00
148_A	151_R	1.009	1.00
69_A	75_A	1.006	1.00
12_T	16_G	0.996	1.00
21_L	25_G	0.994	1.00
68_A	118_A	0.990	1.00
103_N	138_R	0.988	1.00
133_L	137_P	0.986	1.00
106_A	134_Y	0.983	1.00
130_A	133_L	0.954	1.00
68_A	79_S	0.952	1.00
66_P	92_V	0.935	1.00
59_P	142_A	0.932	1.00
79_S	118_A	0.929	1.00
6_R	10_V	0.925	1.00
114_D	128_S	0.922	1.00
15_T	18_A	0.921	1.00
13_V	18_A	0.894	1.00
149_Q	156_A	0.892	1.00
31_F	34_Q	0.891	1.00
91_R	94_A	0.881	1.00
81_L	88_L	0.873	1.00
56_F	64_G	0.872	1.00
88_L	91_R	0.871	1.00
72_D	75_A	0.871	1.00
38_S	49_S	0.867	1.00
99_L	115_L	0.865	1.00
94_A	97_A	0.863	1.00
112_P	134_Y	0.862	1.00
114_D	127_I	0.860	1.00
105_G	141_K	0.858	1.00
69_A	77_G	0.857	1.00
16_G	20_P	0.854	1.00
6_R	9_L	0.854	1.00
77_G	80_N	0.853	1.00
22_A	25_G	0.853	1.00
63_H	138_R	0.849	1.00
105_G	109_A	0.847	1.00
155_A	158_T	0.844	1.00
99_L	103_N	0.837	1.00
27_A	35_A	0.835	1.00
79_S	91_R	0.823	1.00
53_G	71_Y	0.821	1.00
58_D	63_H	0.815	1.00
8_T	15_T	0.812	1.00
97_A	100_R	0.809	1.00
154_V	158_T	0.800	1.00
115_L	127_I	0.787	1.00
62_F	153_L	0.786	1.00
38_S	50_E	0.785	1.00
8_T	11_L	0.784	1.00
4_A	8_T	0.784	1.00
26_I	29_V	0.782	1.00
62_F	154_V	0.776	1.00
64_G	71_Y	0.773	1.00
111_V	134_Y	0.770	1.00
73_A	123_L	0.768	1.00
17_L	20_P	0.765	1.00
139_V	142_A	0.764	1.00
114_D	131_A	0.762	1.00
24_T	27_A	0.759	1.00
100_R	108_T	0.754	1.00
163_L	166_L	0.751	1.00
17_L	21_L	0.749	1.00
76_S	121_S	0.747	1.00
24_T	28_Q	0.744	1.00
92_V	117_T	0.739	1.00
70_G	77_G	0.739	1.00
3_P	7_L	0.735	1.00
16_G	24_T	0.728	1.00
85_N	89_I	0.726	1.00
172_N	175_E	0.725	1.00
89_I	92_V	0.719	1.00
174_L	178_L	0.716	1.00
95_R	99_L	0.714	1.00
81_L	87_A	0.705	1.00
41_E	45_K	0.700	1.00
139_V	176_L	0.694	1.00
105_G	134_Y	0.693	1.00
52_I	123_L	0.689	1.00
86_P	89_I	0.685	1.00
111_V	116_V	0.683	1.00
40_I	174_L	0.681	1.00
92_V	116_V	0.680	1.00
63_H	103_N	0.680	1.00
11_L	14_L	0.677	1.00
153_L	179_A	0.677	1.00
56_F	61_Y	0.677	1.00
151_R	154_V	0.676	1.00
60_K	142_A	0.675	1.00
104_P	134_Y	0.672	1.00
153_L	157_H	0.672	1.00
162_Q	165_F	0.670	1.00
14_L	18_A	0.666	1.00
127_I	131_A	0.664	1.00
19_Y	23_V	0.662	1.00
140_A	143_R	0.652	1.00
127_I	173_V	0.645	1.00
143_R	150_V	0.643	1.00
103_N	134_Y	0.640	1.00
78_G	118_A	0.636	1.00
63_H	99_L	0.635	1.00
110_P	134_Y	0.631	1.00
161_R	167_G	0.631	1.00
175_E	179_A	0.627	1.00
73_A	76_S	0.625	1.00
66_P	81_L	0.625	1.00
175_E	178_L	0.619	1.00
93_K	96_V	0.615	1.00
56_F	174_L	0.614	1.00
104_P	108_T	0.614	1.00
33_D	41_E	0.612	1.00
22_A	26_I	0.605	1.00
57_T	61_Y	0.604	1.00
21_L	24_T	0.604	1.00
99_L	102_E	0.601	1.00
92_V	95_R	0.599	1.00
53_G	69_A	0.596	1.00
79_S	95_R	0.596	1.00
13_V	17_L	0.593	1.00
10_V	14_L	0.592	1.00
17_L	24_T	0.591	1.00
99_L	111_V	0.588	1.00
103_N	109_A	0.587	1.00
63_H	134_Y	0.579	1.00
164_G	167_G	0.578	1.00
74_A	77_G	0.575	1.00
113_V	116_V	0.574	1.00
100_R	110_P	0.569	1.00
98_A	101_A	0.567	1.00
64_G	115_L	0.566	1.00
88_L	92_V	0.563	1.00
81_L	91_R	0.563	1.00
63_H	98_A	0.560	1.00
9_L	12_T	0.559	1.00
143_R	180_L	0.559	1.00
103_N	137_P	0.559	1.00
9_L	13_V	0.557	1.00
71_Y	123_L	0.556	1.00
10_V	13_V	0.556	1.00
136_V	139_V	0.555	1.00
70_G	75_A	0.555	1.00
100_R	104_P	0.553	1.00
5_L	9_L	0.551	1.00
102_E	106_A	0.547	1.00
99_L	106_A	0.543	1.00
155_A	160_G	0.542	1.00
34_Q	50_E	0.541	1.00
82_G	88_L	0.539	1.00
81_L	118_A	0.535	1.00
4_A	7_L	0.532	1.00
159_E	172_N	0.530	1.00
40_I	50_E	0.529	1.00
100_R	111_V	0.528	1.00
23_V	26_I	0.526	1.00
18_A	21_L	0.525	1.00
126_H	175_E	0.525	1.00
33_D	38_S	0.523	1.00
114_D	130_A	0.521	1.00
163_L	167_G	0.519	1.00
113_V	130_A	0.517	1.00
34_Q	38_S	0.517	1.00
103_N	108_T	0.513	1.00
40_I	175_E	0.509	1.00
92_V	96_V	0.509	1.00
100_R	106_A	0.508	1.00
47_V	178_L	0.508	1.00
11_L	20_P	0.505	1.00
27_A	30_L	0.505	1.00
58_D	142_A	0.505	1.00
84_T	89_I	0.502	1.00
132_A	139_V	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4lhfA	1	0.2857	33.3	0.951	Contact Map
3ne5A	3	0.9176	26.1	0.953	Contact Map
4mt1A	3	0.9341	11.7	0.96	Contact Map
4dx5A	3	0.967	11.5	0.96	Contact Map
4xrvA	1	0.7473	8.5	0.962	Contact Map
1toaA	1	0.8352	8.5	0.962	Contact Map
3w6vA	1	0.3407	6.5	0.964	Contact Map
4utoA	1	0.8297	6.4	0.965	Contact Map
4c2mD	1	0.3022	6.3	0.965	Contact Map
4h63V	1	0.5385	6.3	0.965	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.